• Gene id: 112574

Gene Summary

• Gene Symbol: SNX18   Gene   UCSC   Ensembl
• Aliases: SH3PX2, SH3PXD3B, SNAG1
• Gene name: sorting nexin 18
• Alternate names: sorting nexin-18, SH3 and PX domain-containing protein 3B, sorting nexin associated golgi protein 1, sorting nexin-associated Golgi protein 1,
• Gene location: 5q11.2 (54517758: 54619248)     Exons: 4     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like
• OMIM: 612606

Protein Summary

• Protein general information: Q96RF0  
  • Name: Sorting nexin 18 (SH3 and PX domain containing protein 3B) (Sorting nexin associated Golgi protein 1)
  • Length: 628  
  • Mass: 68894
• Sequence:

  MALRARALYDFRSENPGEISLREHEVLSLCSEQDIEGWLEGVNSRGDRGLFPASYVQVIRAPEPGPAGDGGPGAP
  ARYANVPPGGFEPLPVAPPASFKPPPDAFQALLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQLYGGYQASQGS
  DDDWDDEWDDSSTVADEPGALGSGAYPDLDGSSSAGVGAAGRYRLSTRSDLSLGSRGGSVPPQHHPSGPKSSATV
  SRNLNRFSTFVKSGGEAFVLGEASGFVKDGDKLCVVLGPYGPEWQENPYPFQCTIDDPTKQTKFKGMKSYISYKL
  VPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFISKRRKGLIWWMNHMASHPVLAQCDVF
  QHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALDLQEVESKIDGFKCFTKKMDDSALQLNHTAN
  EFARKQVTGFKKEYQKVGQSFRGLSQAFELDQQAFSVGLNQAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALY
  QGHLANFPDIIHVQKGKAWPLEQVIWSVLCRLKGATLTAVPLWVSESYSTGEEASRDVDAWVFSLECKLDCSTGS
  FLLEYLALGNEYSFSKVQRVPLMTVLSF

• Structural information:
  • Protein Domains: (1..6-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (276..38-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147-)
    (421..62-)
    (/note="BAR"-)
  • Interpro: IPR027267  IPR001683  IPR036871  IPR036028  IPR001452   IPR035703  IPR035557  IPR014536  IPR019497  
  • Prosite: PS50195 PS50002
  • CDD: cd07286 cd11897
  • STRING: ENSP00000317332
• Other Databases: GeneCards:  SNX18  Malacards:  SNX18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0030136	clathrin-coated vesicle	IDA	colocalizes with
GO:0006897	endocytosis	IDA	biological process
GO:0036089	cleavage furrow formation	IMP	biological process
GO:0016197	endosomal transport	IMP	biological process
GO:0006897	endocytosis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000281	mitotic cytokinesis	IMP	biological process
GO:0000278	mitotic cell cycle	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005546	phosphatidylinositol-4,5-bisphosphate binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0012505	endomembrane system	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881