• Gene id: 112495

Gene Summary

• Gene Symbol: GTF3C6   Gene   UCSC   Ensembl
• Aliases: C6orf51, TFIIIC35, bA397G5.3
• Gene name: general transcription factor IIIC subunit 6
• Alternate names: general transcription factor 3C polypeptide 6, TFIIIC 35 kDa subunit, general transcription factor IIIC, polypeptide 6, alpha 35kDa, transcription factor IIIC 35 kDa subunit, transcription factor IIIC 35kDa, transcription factor IIIC subunit 6,
• Gene location: 6q21 (181317711: 181808083)     Exons: 52     NC_000001.11
• Gene summary(Entrez): RNA polymerases are unable to initiate RNA synthesis in the absence of additional proteins called general transcription factors (GTFs). GTFs assemble in a complex on the DNA promoter and recruit the RNA polymerase. GTF3C family proteins (e.g., GTF3C1, MIM
• OMIM: 611784

Protein Summary

• Protein general information: Q969F1  
  • Name: General transcription factor 3C polypeptide 6 (Transcription factor IIIC 35 kDa subunit) (TFIIIC 35 kDa subunit) (TFIIIC35) (Transcription factor IIIC subunit 6)
  • Length: 213  
  • Mass: 24049
• Sequence:

  MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSCVFAGEYEDTLGTCVI
  FEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENIGGVEWLQIKDNDFSYRPNMICNFLHENEDE
  EVVASAPDKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP

• Structural information:
  • Interpro: IPR042771  IPR019481  
  • STRING: ENSP00000357863
• Other Databases: GeneCards:  GTF3C6  Malacards:  GTF3C6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006383	transcription by RNA polymerase III	IDA	biological process
GO:0003677	DNA binding	IDA	contributes to
GO:0042797	tRNA transcription by RNA polymerase III	IC	biological process
GO:0000127	transcription factor TFIIIC complex	IDA	cellular component
GO:0042791	5S class rRNA transcription by RNA polymerase III	IC	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000127	transcription factor TFIIIC complex	IBA	cellular component
GO:0006383	transcription by RNA polymerase III	IBA	biological process
GO:0006383	transcription by RNA polymerase III	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq