• Gene id: 112464

Gene Summary

• Gene Symbol: CAVIN3   Gene   UCSC   Ensembl
• Aliases: HSRBC, PRKCDBP, SRBC, cavin-3
• Gene name: caveolae associated protein 3
• Alternate names: caveolae-associated protein 3, protein kinase C delta binding protein, sdr-related gene product that binds to c-kinase, serum deprivation response factor-related gene product that binds to C-kinase,
• Gene location: 11p15.4 (6320500: 6318945)     Exons: 2     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene was identified as a binding protein of the protein kinase C, delta (PRKCD). The expression of this gene in cultured cell lines is strongly induced by serum starvation. The expression of this protein was found to be down-re
• OMIM: 618303

Protein Summary

• Protein general information: Q969G5  
  • Name: Caveolae associated protein 3 (Cavin 3) (Protein kinase C delta binding protein) (Serum deprivation response factor related gene product that binds to C kinase) (hSRBC)
  • Length: 261  
  • Mass: 27701
  • Tissue specificity: Skeletal muscle, liver, stomach, lung, kidney and heart (at protein level). Strongly expressed in mammary and epithelial cells. {ECO
• Sequence:

  MRESALERGPVPEAPAGGPVHAVTVVTLLEKLASMLETLRERQGGLARRQGGLAGSVRRIQSGLGALSRSHDTTS
  NTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQKAPEPLGPADQ
  SELGPEQLEAEVGESSDEEPVESRAQRLRRTGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQ
  PALEPTLEPEPPQDTEEDPGRPGAAEEALLQMESVA

• Structural information:
  • Interpro: IPR033300  IPR026752  
  • DIP: 60484
  • STRING: ENSP00000307292
• Other Databases: GeneCards:  CAVIN3  Malacards:  CAVIN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005901	caveola	IEA	cellular component
GO:0005901	caveola	IBA	cellular component
GO:0005080	protein kinase C binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0048511	rhythmic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1901003	negative regulation of fermentation	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0051898	negative regulation of protein kinase B signaling	IEA	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0030866	cortical actin cytoskeleton organization	IEA	biological process
GO:0005901	caveola	IEA	cellular component
GO:0005080	protein kinase C binding	IEA	molecular function
GO:0005080	protein kinase C binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005901	caveola	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005901	caveola	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0032922	circadian regulation of gene expression	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray