• Gene id: 11240

Gene Summary

• Gene Symbol: PADI2   Gene   UCSC   Ensembl
• Aliases: PAD-H19, PAD2, PDI2
• Gene name: peptidyl arginine deiminase 2
• Alternate names: protein-arginine deiminase type-2, peptidyl arginine deiminase, type II, protein-arginine deiminase type II,
• Gene location: 1p36.13 (17119452: 17066760)     Exons: 17     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the peptidyl arginine deiminase family of enzymes, which catalyze the post-translational deimination of proteins by converting arginine residues into citrullines in the presence of calcium ions. The family members have distin
• OMIM: 607935

Protein Summary

• Protein general information: Q9Y2J8  
  • Name: Protein arginine deiminase type 2 (EC 3.5.3.15) (PAD H19) (Peptidylarginine deiminase II) (Protein arginine deiminase type II)
  • Length: 665  
  • Mass: 75564
  • Tissue specificity: Detected in keratinocytes in epidermis (at protein level). {ECO
• Sequence:

  MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPST
  TLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASWTWGPEGQGAI
  LLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQR
  YIHILGRRKLYHVVKYTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMT
  PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEAPHKGFPVVLDSPRDG
  NLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVNGKTYPLGRILIGSSFPLSGGRRMTKVVRDF
  LKAQQVQAPVELYSDWLTVGHVDEFMSFVPIPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKR
  ITINKILSNESLVQENLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGI
  PKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKWWHMVP

• Structural information:
  • Interpro: IPR008972  IPR004303  IPR013530  IPR036556  IPR013732   IPR038685  IPR013733  
  • PDB: 4N20 4N22 4N24 4N25 4N26 4N28 4N2A 4N2B 4N2C 4N2D 4N2E 4N2F 4N2G 4N2H 4N2I 4N2K 4N2L 4N2M 4N2N
  • PDBsum: 4N20 4N22 4N24 4N25 4N26 4N28 4N2A 4N2B 4N2C 4N2D 4N2E 4N2F 4N2G 4N2H 4N2I 4N2K 4N2L 4N2M 4N2N
  • STRING: ENSP00000364635
• Other Databases: GeneCards:  PADI2  Malacards:  PADI2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004668	protein-arginine deiminase activity	IBA	molecular function
GO:0036414	histone citrullination	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0004668	protein-arginine deiminase activity	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0018101	protein citrullination	IDA	biological process
GO:0004668	protein-arginine deiminase activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0018101	protein citrullination	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004668	protein-arginine deiminase activity	IEA	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006325	chromatin organization	TAS	biological process
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0035327	transcriptionally active chromatin	IDA	cellular component
GO:0004668	protein-arginine deiminase activity	IDA	molecular function
GO:0004668	protein-arginine deiminase activity	IDA	molecular function
GO:0004668	protein-arginine deiminase activity	IDA	molecular function
GO:0036413	histone H3-R26 citrullination	IDA	biological process
GO:0018101	protein citrullination	IDA	biological process
GO:0018101	protein citrullination	IDA	biological process
GO:1901624	negative regulation of lymphocyte chemotaxis	IDA	biological process
GO:0070100	negative regulation of chemokine-mediated signaling pathway	IDA	biological process
GO:0021762	substantia nigra development	HEP	biological process
GO:0004668	protein-arginine deiminase activity	IDA	molecular function
GO:0010848	regulation of chromatin disassembly	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0048096	chromatin-mediated maintenance of transcription	IMP	biological process
GO:0030520	intracellular estrogen receptor signaling pathway	IMP	biological process
GO:0030331	estrogen receptor binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray