• Gene id: 1124

Gene Summary

• Gene Symbol: CHN2   Gene   UCSC   Ensembl
• Aliases: ARHGAP3, BCH, CHN2-3, RHOGAP3
• Gene name: chimerin 2
• Alternate names: beta-chimaerin, beta-chimerin, beta3-chimaerin, chimerin (chimaerin) 2, chimerin, beta-2, chimerin, testis-specific, rho-GTPase-activating protein 3,
• Gene location: 7p14.3 (29146546: 29514334)     Exons: 3     NC_000007.14
• Gene summary(Entrez): This gene encodes a guanosine triphosphate (GTP)-metabolizing protein that contains a phorbol-ester/diacylglycerol (DAG)-type zinc finger, a Rho-GAP domain, and an SH2 domain. The encoded protein translocates from the cytosol to the Golgi apparatus membra
• OMIM: 602857

Protein Summary

• Protein general information: P52757  
  • Name: Beta chimaerin (Beta chimerin) (Rho GTPase activating protein 3)
  • Length: 468  
  • Mass: 53924
  • Tissue specificity: Highest levels in the brain and pancreas. Also expressed in the heart, placenta, and weakly in the kidney and liver. Expression is much reduced in the malignant gliomas, compared to normal brain or low-grade astrocytomas.
• Sequence:

  MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREFHGIISREQADELLGG
  VEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRFESIHDLVTDGLITLYIETKAAEYISKMTTN
  PIYEHIGYATLLREKVSRRLSRSKNEPRKTNVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGP
  HWCEYCANFMWGLIAQGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIRE
  IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDA
  AKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNFMNAENLGIVFGPTLMRPPEDSTLTTLHDM
  RYQKLIVQILIENEDVLF

• Structural information:
  • Protein Domains: (59..12-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (277..46-)
    (/note="Rho-GAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00172"-)
  • Interpro: IPR035840  IPR017356  IPR020454  IPR002219  IPR008936   IPR037860  IPR000198  IPR000980  IPR036860  
  • Prosite: PS50238 PS50001 PS00479 PS50081
  • CDD: cd00029 cd04372 cd10352
  • PDB: 1XA6
  • PDBsum: 1XA6
  • STRING: ENSP00000222792
• Other Databases: GeneCards:  CHN2  Malacards:  CHN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043087	regulation of GTPase activity	IBA	biological process
GO:0005096	GTPase activator activity	IBA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0051056	regulation of small GTPase mediated signal transduction	IEA	biological process
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005096	GTPase activator activity	IEA	molecular function
GO:0005096	GTPase activator activity	TAS	molecular function
GO:0045202	synapse	IDA	cellular component
GO:0005096	GTPase activator activity	IDA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881