• Gene id: 11237

Gene Summary

• Gene Symbol: RNF24   Gene   UCSC   Ensembl
• Aliases: G1L
• Gene name: ring finger protein 24
• Alternate names: RING finger protein 24,
• Gene location: 20p13 (4015587: 3927310)     Exons: 10     NC_000020.11
• Gene summary(Entrez): This gene encodes an integral membrane protein that contains a RING-type zinc finger. The encoded protein may interact with multiple transient receptor potential cation channel subfamily C (TRPC) proteins and regulate the trafficking and insertion of thes
• OMIM: 607057

Protein Summary

• Protein general information: Q9Y225  
  • Name: RING finger protein 24
  • Length: 148  
  • Mass: 17210
• Sequence:

  MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCCYLIRLRHQAHKEFYAYKQVILKEKVKELNLH
  ELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGPLPGAENIV

• Structural information:
  • Interpro: IPR040098  IPR001841  IPR011016  IPR013083  
  • Prosite: PS50089
  • PDB: 2EP4
  • PDBsum: 2EP4
  • STRING: ENSP00000388550
• Other Databases: GeneCards:  RNF24  Malacards:  RNF24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0012505	endomembrane system	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq