• Gene id: 11235

Gene Summary

• Gene Symbol: PDCD10   Gene   UCSC   Ensembl
• Aliases: CCM3, TFAR15
• Gene name: programmed cell death 10
• Alternate names: programmed cell death protein 10, TF-1 cell apoptosis-related protein 15, apoptosis-related protein 15, cerebral cavernous malformations 3 protein,
• Gene location: 3q26.1 (43576146: 43620522)     Exons: 11     NC_000006.12
• Gene summary(Entrez): This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is ph
• OMIM: 609118

Protein Summary

• Protein general information: Q9BUL8  
  • Name: Programmed cell death protein 10 (Cerebral cavernous malformations 3 protein) (TF 1 cell apoptosis related protein 15)
  • Length: 212  
  • Mass: 24702
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVN
  FTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFK
  KYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

• Structural information:
  • Interpro: IPR009652  
  • PDB: 3AJM 3L8I 3L8J 3RQE 3RQF 3RQG 3W8H 3W8I 4GEH 4TVQ
  • PDBsum: 3AJM 3L8I 3L8J 3RQE 3RQF 3RQG 3W8H 3W8I 4GEH 4TVQ
  • DIP: 40607
  • STRING: ENSP00000376506
• Other Databases: GeneCards:  PDCD10  Malacards:  PDCD10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0090316	positive regulation of intracellular protein transport	IMP	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0032874	positive regulation of stress-activated MAPK cascade	IDA	biological process
GO:0042542	response to hydrogen peroxide	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071902	positive regulation of protein serine/threonine kinase activity	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051683	establishment of Golgi localization	IMP	biological process
GO:0043149	stress fiber assembly	IMP	NOT|biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:1903588	negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IMP	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0090168	Golgi reassembly	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0045747	positive regulation of Notch signaling pathway	IMP	biological process
GO:0036481	intrinsic apoptotic signaling pathway in response to hydrogen peroxide	IGI	biological process
GO:0050821	protein stabilization	IMP	biological process
GO:0044319	wound healing, spreading of cells	IMP	biological process
GO:0035023	regulation of Rho protein signal transduction	IMP	NOT|biological process
GO:0019901	protein kinase binding	IPI	molecular function

Diseases

Associated diseases	References
Cerebral cavernous malformation	KEGG:H00534
Cerebral cavernous malformation	KEGG:H00534
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)