• Gene id: 11231

Gene Summary

• Gene Symbol: SEC63   Gene   UCSC   Ensembl
• Aliases: DNAJC23, ERdj2, PCLD2, PRO2507, SEC63L
• Gene name: SEC63 homolog, protein translocation regulator
• Alternate names: translocation protein SEC63 homolog, SEC63 protein translocation regulator, SEC63-like protein,
• Gene location: 6q21 (107958207: 107867755)     Exons: 21     NC_000006.12
• Gene summary(Entrez): The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. The protein encoded by this gene and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated
• OMIM: 608648

Protein Summary

• Protein general information: Q9UGP8  
  • Name: Translocation protein SEC63 homolog
  • Length: 760  
  • Mass: 87997
  • Tissue specificity: Widely expressed, with high levels in the liver. {ECO
• Sequence:

  MAGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVK
  KIVLLAGWALFLFLAYKVSKTDREYQEYNPYEVLNLDPGATVAEIKKQYRLLSLKYHPDKGGDEVMFMRIAKAYA
  ALTDEESRKNWEEFGNPDGPQATSFGIALPAWIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILI
  RTTQIYTYFVYKTRNMDMKRLIMVLAGASEFDPQYNKDATSRPTDNILIPQLIREIGSINLKKNEPPLTCPYSLK
  ARVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQLIVMARNREEREFRAPTLASLENCMKLSQMAVQ
  GLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIQDLVSLKESDRHTLLHFLEDEKYEEVMAVLGSFPYVTMDIK
  SQVLDDEDSNNITVGSLVTVLVKLTRQTMAEVFEKEQSICAAEEQPAEDGQGETNKNRTKGGWQQKSKGPKKTAK
  SKKKKPLKKKPTPVLLPQSKQQKQKQANGVVGNEAAVKEDEEEVSDKGSDSEEEETNRDSQSEKDDGSDRDSDRE
  QDEKQNKDDEAEWQELQQSIQRKERALLETKSKITHPVYSLYFPEEKQEWWWLYIADRKEQTLISMPYHVCTLKD
  TEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAKPVPENHPQWDTAIEGDEDQEDSEGFEDSFE
  EEEEEEEDDD

• Structural information:
  • Protein Domains: (104..16-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286-)
    (197..54-)
    (/note="SEC63-1)
    (637..71-)
    (/note="SEC63-2")
  • Interpro: IPR035892  IPR001623  IPR014756  IPR036869  IPR027137   IPR004179  
  • Prosite: PS50076
  • CDD: cd06257
  • STRING: ENSP00000357998
• Other Databases: GeneCards:  SEC63  Malacards:  SEC63

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IBA	molecular function
GO:0006620	posttranslational protein targeting to endoplasmic reticulum membrane	IBA	biological process
GO:0008320	protein transmembrane transporter activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	IBA	biological process
GO:0031207	Sec62/Sec63 complex	IBA	cellular component
GO:0031204	posttranslational protein targeting to membrane, translocation	IMP	biological process
GO:0031204	posttranslational protein targeting to membrane, translocation	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0006612	protein targeting to membrane	TAS	biological process
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	IMP	biological process
GO:0006620	posttranslational protein targeting to endoplasmic reticulum membrane	IMP	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006807	nitrogen compound metabolic process	IEA	biological process
GO:0006614	SRP-dependent cotranslational protein targeting to membrane	IEA	biological process
GO:0010259	multicellular organism aging	IEA	biological process
GO:0006620	posttranslational protein targeting to endoplasmic reticulum membrane	IEA	biological process
GO:0001889	liver development	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum
hsa03060	Protein export

Diseases

Associated diseases	References
Polycystic liver disease	KEGG:H00545
Polycystic liver disease	KEGG:H00545
Polycystic liver disease	PMID:15133510
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)