• Gene id: 11221

Gene Summary

• Gene Symbol: DUSP10   Gene   UCSC   Ensembl
• Aliases: MKP-5, MKP5
• Gene name: dual specificity phosphatase 10
• Alternate names: dual specificity protein phosphatase 10, dual specificity phosphatase MKP-5, map kinase phosphatase 5, mitogen-activated protein kinase phosphatase 5, serine/threonine specific protein phosphatase,
• Gene location: 1q41 (221742175: 221701419)     Exons: 5     NC_000001.11
• Gene summary(Entrez): Dual specificity protein phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the MAP kinase superfamily, which is associated with cellular pro
• OMIM: 611178

Protein Summary

• Protein general information: Q9Y6W6  
  • Name: Dual specificity protein phosphatase 10 (EC 3.1.3.16) (EC 3.1.3.48) (Mitogen activated protein kinase phosphatase 5) (MAP kinase phosphatase 5) (MKP 5)
  • Length: 482  
  • Mass: 52642
  • Tissue specificity: Expressed in keratinocytes (at protein level) (PubMed
• Sequence:

  MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLGSANPGSNSHPPVIATTVVSLKAANLTYMPSSSGSARSLNCGC
  SSASCCTVATYDKDNQAQTQAIAAGTTTTAIGTSTTCPANQMVNNNENTGSLSPSSGVGSPVSGTPKQLASIKII
  YPNDLAKKMTKCSKSHLPSQGPVIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSF
  KRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQECREVGGGA
  SAASSLLPQPIPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPA
  TDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLN
  FMGQLLEFEEDLNNGVTPRILTPKLMGVETVV

• Structural information:
  • Protein Domains: (168..28-)
    (/note="Rhodanese-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00173-)
    (384..45-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR020417  IPR000340  IPR008343  IPR029021  IPR001763   IPR036873  IPR016130  IPR000387  IPR020422  
  • Prosite: PS50206 PS00383 PS50056 PS50054
  • PDB: 1ZZW 2OUC 2OUD 3TG1
  • PDBsum: 1ZZW 2OUC 2OUD 3TG1
  • STRING: ENSP00000355866
• Other Databases: GeneCards:  DUSP10  Malacards:  DUSP10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051019	mitogen-activated protein kinase binding	IBA	molecular function
GO:0043508	negative regulation of JUN kinase activity	IBA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IBA	molecular function
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:0046329	negative regulation of JNK cascade	IBA	biological process
GO:0035970	peptidyl-threonine dephosphorylation	IBA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IBA	biological process
GO:0033550	MAP kinase tyrosine phosphatase activity	IBA	molecular function
GO:0008330	protein tyrosine/threonine phosphatase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0000188	inactivation of MAPK activity	IBA	biological process
GO:0033549	MAP kinase phosphatase activity	IDA	molecular function
GO:0016791	phosphatase activity	IDA	molecular function
GO:0000188	inactivation of MAPK activity	IDA	biological process
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0016311	dephosphorylation	IDA	biological process
GO:0016791	phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002819	regulation of adaptive immune response	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0043508	negative regulation of JUN kinase activity	IEA	biological process
GO:0044387	negative regulation of protein kinase activity by regulation of protein phosphorylation	IEA	biological process
GO:0050680	negative regulation of epithelial cell proliferation	IEA	biological process
GO:0060266	negative regulation of respiratory burst involved in inflammatory response	IEA	biological process
GO:1905042	negative regulation of epithelium regeneration	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0048715	negative regulation of oligodendrocyte differentiation	IEA	biological process
GO:0010633	negative regulation of epithelial cell migration	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032873	negative regulation of stress-activated MAPK cascade	IEA	biological process
GO:0033549	MAP kinase phosphatase activity	IEA	molecular function
GO:0045088	regulation of innate immune response	IEA	biological process
GO:0046329	negative regulation of JNK cascade	IEA	biological process
GO:0048709	oligodendrocyte differentiation	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0090335	regulation of brown fat cell differentiation	IEA	biological process
GO:0008330	protein tyrosine/threonine phosphatase activity	IDA	molecular function
GO:0008432	JUN kinase binding	IDA	molecular function
GO:0048273	mitogen-activated protein kinase p38 binding	IPI	molecular function
GO:0033549	MAP kinase phosphatase activity	ISS	molecular function
GO:0043508	negative regulation of JUN kinase activity	IDA	biological process
GO:1990264	peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0046329	negative regulation of JNK cascade	IDA	biological process
GO:0030336	negative regulation of cell migration	NAS	biological process
GO:0050680	negative regulation of epithelial cell proliferation	ISS	biological process
GO:1905042	negative regulation of epithelium regeneration	ISS	biological process
GO:1903753	negative regulation of p38MAPK cascade	IDA	biological process
GO:0035970	peptidyl-threonine dephosphorylation	IDA	biological process
GO:0045591	positive regulation of regulatory T cell differentiation	IMP	biological process
GO:1903753	negative regulation of p38MAPK cascade	NAS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0010633	negative regulation of epithelial cell migration	ISS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray