• Gene id: 11216

Gene Summary

• Gene Symbol: AKAP10   Gene   UCSC   Ensembl
• Aliases: AKAP-10, D-AKAP-2, D-AKAP2, PRKA10
• Gene name: A-kinase anchoring protein 10
• Alternate names: A-kinase anchor protein 10, mitochondrial, A kinase (PRKA) anchor protein 10, A kinase anchor protein 10, dual specificity A kinase-anchoring protein 2, mitochondrial A kinase PPKA anchor protein 10, protein kinase A anchoring protein 10,
• Gene location: 17p11.2 (19977855: 19904301)     Exons: 16     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the A-kinase anchor protein family. A-kinase anchor proteins bind to the regulatory subunits of protein kinase A (PKA) and confine the holoenzyme to discrete locations within the cell. The encoded protein is localized to mito

Protein Summary

• Protein general information: O43572  
  • Name: A kinase anchor protein 10, mitochondrial (AKAP 10) (Dual specificity A kinase anchoring protein 2) (D AKAP 2) (Protein kinase A anchoring protein 10) (PRKA10)
  • Length: 662  
  • Mass: 73818
• Sequence:

  MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNHALLEAAGPSHVAINA
  ISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKSSLSKTLEQVLHDTIVLPYFIQFMELRRMEH
  LVKFWLEAESFHSTTWSRIRAHSLNTVKQSSLAEPVSPSKKHETTASFLTDSLDKRLEDSGSAQLFMTHSEGIDL
  NNRTNSTQNHLLLSQECDSAHSLRLEMARAGTHQVSMETQESSSTLTVASRNSPASPLKELSGKLMKSIEQDAVN
  TFTKYISPDAAKPIPITEAMRNDIIARICGEDGQVDPNCFVLAQSIVFSAMEQEHFSEFLRSHHFCKYQIEVLTS
  GTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLAAKKGQYDGQEAQNDAMILYDKYFSLQATHP
  LGFDDVVRLEIESNICREGGPLPNCFTTPLRQAWTTMEKVFLPGFLSSNLYYKYLNDLIHSVRGDEFLGGNVSLT
  APGSVGPPDESHPGSSDSSASQSSVKKASIKILKNFDEAIIVDAASLDPESLYQRTYAGKMTFGRVSDLGQFIRE
  SEPEPDVRKSKGSMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDIMQQAQYDQPLEKSTKL

• Structural information:
  • Protein Domains: (125..36-)
    (/note="RGS-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171-)
    (379..50-)
    (/note="RGS-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00171"-)
  • Interpro: IPR037719  IPR016137  IPR036305  
  • Prosite: PS50132
  • CDD: cd12804
  • PDB: 3IM4 3TMH
  • PDBsum: 3IM4 3TMH
  • DIP: 48753
  • STRING: ENSP00000225737
• Other Databases: GeneCards:  AKAP10  Malacards:  AKAP10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008104	protein localization	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0051018	protein kinase A binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0008104	protein localization	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0008104	protein localization	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0051018	protein kinase A binding	IPI	molecular function
GO:0051018	protein kinase A binding	IPI	molecular function
GO:0008104	protein localization	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0051018	protein kinase A binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0008104	protein localization	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0008104	protein localization	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0051018	protein kinase A binding	IPI	molecular function
GO:0051018	protein kinase A binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq