• Gene id: 11213

Gene Summary

• Gene Symbol: IRAK3   Gene   UCSC   Ensembl
• Aliases: ASRT5, IRAKM
• Gene name: interleukin 1 receptor associated kinase 3
• Alternate names: interleukin-1 receptor-associated kinase 3, IL-1 receptor-associated kinase M,
• Gene location: 12q14.3 (66189213: 66254621)     Exons: 12     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the interleukin-1 receptor-associated kinase protein family. Members of this family are essential components of the Toll/IL-R immune signal transduction pathways. This protein is primarily expressed in monocytes and macrophag
• OMIM: 604459

Protein Summary

• Protein general information: Q9Y616  
  • Name: Interleukin 1 receptor associated kinase 3 (IRAK 3) (EC 2.7.11.1) (IL 1 receptor associated kinase M) (IRAK M)
  • Length: 596  
  • Mass: 67767
  • Tissue specificity: Expressed predominantly in peripheral blood lymphocytes. {ECO
• Sequence:

  MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEKYVDQGKSGTRELLWS
  WAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIPEHNEKGILLK
  SSISFQNIIEGTRNFHKDFLIGEGEIFEVYRVEIQNLTYAVKLFKQEKKMQCKKHWKRFLSELEVLLLFHHPNIL
  ELAAYFTETEKFCLIYPYMRNGTLFDRLQCVGDTAPLPWHIRIGILIGISKAIHYLHNVQPCSVICGSISSANIL
  LDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGKLSIKTDVYSFGIVIMEVLTGCRVVL
  DDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFCLAGRCAATRAKLRPSMDEVLNTLESTQASL
  YFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLLPSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPES
  KRNEEACNMPSSSCEESWFPKYIVPSQDLRPYKVNIDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE

• Structural information:
  • Protein Domains: (41..10-)
    (/note="Death-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00064-)
    (165..45-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011029  IPR000488  IPR033610  IPR042747  IPR042698   IPR011009  IPR000719  
  • Prosite: PS50017 PS50011
  • CDD: cd08796 cd14160
  • PDB: 5UKE
  • PDBsum: 5UKE
  • STRING: ENSP00000261233
• Other Databases: GeneCards:  IRAK3  Malacards:  IRAK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IBA	biological process
GO:0032695	negative regulation of interleukin-12 production	IBA	biological process
GO:0019221	cytokine-mediated signaling pathway	IBA	biological process
GO:0070498	interleukin-1-mediated signaling pathway	IBA	biological process
GO:0043407	negative regulation of MAP kinase activity	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0045824	negative regulation of innate immune response	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0034122	negative regulation of toll-like receptor signaling pathway	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0010936	negative regulation of macrophage cytokine production	IEA	biological process
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0032494	response to peptidoglycan	IEA	biological process
GO:0032695	negative regulation of interleukin-12 production	IEA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IEA	biological process
GO:0042177	negative regulation of protein catabolic process	IEA	biological process
GO:0043330	response to exogenous dsRNA	IEA	biological process
GO:0045824	negative regulation of innate immune response	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0010933	positive regulation of macrophage tolerance induction	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0032715	negative regulation of interleukin-6 production	IEA	biological process
GO:0034122	negative regulation of toll-like receptor signaling pathway	IEA	biological process
GO:0043244	regulation of protein-containing complex disassembly	IEA	biological process
GO:0043407	negative regulation of MAP kinase activity	IEA	biological process
GO:0070498	interleukin-1-mediated signaling pathway	IEA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0009615	response to virus	IC	biological process
GO:0002755	MyD88-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0010936	negative regulation of macrophage cytokine production	ISS	biological process
GO:0032494	response to peptidoglycan	ISS	biological process
GO:0032695	negative regulation of interleukin-12 production	ISS	biological process
GO:0032695	negative regulation of interleukin-12 production	IMP	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IMP	biological process
GO:0042177	negative regulation of protein catabolic process	IMP	biological process
GO:0042177	negative regulation of protein catabolic process	IMP	biological process
GO:0043330	response to exogenous dsRNA	ISS	biological process
GO:0045824	negative regulation of innate immune response	ISS	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0070555	response to interleukin-1	IMP	biological process
GO:0001960	negative regulation of cytokine-mediated signaling pathway	IC	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0010933	positive regulation of macrophage tolerance induction	ISS	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0032715	negative regulation of interleukin-6 production	ISS	biological process
GO:0032715	negative regulation of interleukin-6 production	IMP	biological process
GO:0034122	negative regulation of toll-like receptor signaling pathway	ISS	biological process
GO:0043242	negative regulation of protein-containing complex disassembly	IMP	biological process
GO:0043407	negative regulation of MAP kinase activity	IMP	biological process
GO:0070498	interleukin-1-mediated signaling pathway	IMP	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0019221	cytokine-mediated signaling pathway	ISS	biological process
GO:0043244	regulation of protein-containing complex disassembly	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04722	Neurotrophin signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R