• Gene id: 11202

Gene Summary

• Gene Symbol: KLK8   Gene   UCSC   Ensembl
• Aliases: HNP, NP, NRPN, PRSS19, TADG14
• Gene name: kallikrein related peptidase 8
• Alternate names: kallikrein-8, ovasin, serine protease 19, serine protease TADG-14, tumor-associated differentially expressed gene 14 protein,
• Gene location: 19q13.41 (51001701: 50996007)     Exons: 6     NC_000019.10
• Gene summary(Entrez): Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one
• OMIM: 605644

Protein Summary

• Protein general information: O60259  
  • Name: Kallikrein 8 (hK8) (EC 3.4.21.118) (Neuropsin) (NP) (Ovasin) (Serine protease 19) (Serine protease TADG 14) (Tumor associated differentially expressed gene 14 protein)
  • Length: 260  
  • Mass: 28048
  • Tissue specificity: Isoform 1 is predominantly expressed in the pancreas. Isoform 2 is expressed in adult brain and hippocampus. Isoform 1 and isoform 2 are found in fetal brain and placenta. Detected in salivary gland, uterus, thymus, breast, testis and
• Sequence:

  MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCK
  KPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQ
  KCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGI
  TSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG

• Structural information:
  • Protein Domains: (33..25-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • PDB: 5MS3 5MS4
  • PDBsum: 5MS3 5MS4
• Other Databases: GeneCards:  KLK8  Malacards:  KLK8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007613	memory	IBA	biological process
GO:0030141	secretory granule	IBA	cellular component
GO:0048812	neuron projection morphogenesis	IBA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050808	synapse organization	IEA	biological process
GO:0048681	negative regulation of axon regeneration	IEA	biological process
GO:0043616	keratinocyte proliferation	IEA	biological process
GO:0031642	negative regulation of myelination	IEA	biological process
GO:0009611	response to wounding	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0050807	regulation of synapse organization	IEA	biological process
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0008219	cell death	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0097180	serine protease inhibitor complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004252	serine-type endopeptidase activity	IDA	molecular function
GO:0031642	negative regulation of myelination	ISS	biological process
GO:0007613	memory	ISS	biological process
GO:0050807	regulation of synapse organization	ISS	biological process
GO:0008219	cell death	ISS	biological process
GO:0048681	negative regulation of axon regeneration	ISS	biological process
GO:0043616	keratinocyte proliferation	ISS	biological process
GO:0009611	response to wounding	ISS	biological process
GO:0005615	extracellular space	ISS	cellular component
GO:0048812	neuron projection morphogenesis	ISS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)