• Gene id: 112

Gene Summary

• Gene Symbol: ADCY6   Gene   UCSC   Ensembl
• Aliases: AC6, LCCS8
• Gene name: adenylate cyclase 6
• Alternate names: adenylate cyclase type 6, ATP pyrophosphate-lyase 6, adenylate cyclase type VI, ca(2+)-inhibitable adenylyl cyclase,
• Gene location: 12q13.12 (48789088: 48766193)     Exons: 23     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the adenylyl cyclase family of proteins, which are required for the synthesis of cyclic AMP. All members of this family have an intracellular N-terminus, a tandem repeat of six transmembrane domains separated by a cytoplasmic
• OMIM: 600294

Protein Summary

• Protein general information: O43306  
  • Name: Adenylate cyclase type 6 (EC 4.6.1.1) (ATP pyrophosphate lyase 6) (Adenylate cyclase type VI) (Adenylyl cyclase 6) (Ca(2+) inhibitable adenylyl cyclase)
  • Length: 1168  
  • Mass: 130615
  • Tissue specificity: Detected in peripheral blood mononuclear leukocytes (at protein level) (PubMed
• Sequence:

  MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGPPRCPWQDDAFIRRGG
  PGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWRRLVQVFQSKQFRSAKLERLYQRYFFQMNQS
  SLTLLMAVLVLLTAVLLAFHAAPARPQPAYVALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVG
  GALAADPRSPSAGLWCPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN
  VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKKEDMMFHKIYIQKH
  DNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEM
  GVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLN
  GDYEVEPGRGGERNAYLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
  QMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFGAYVAC
  ALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLITVLICAVYSCGSLFPKALQRLSRSIVRSRAHSTAVGIFSV
  LLVFTSAIANMFTCNHTPIRSCAARMLNLTPADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLL
  ASSVFLHISSIGKLAMIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPV
  ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSC
  ECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQ
  VGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDR
  IQVTTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGPSS

• Structural information:
  • Interpro: IPR001054  IPR018297  IPR032628  IPR030672  IPR009398   IPR029787  
  • Prosite: PS00452 PS50125
  • STRING: ENSP00000311405
• Other Databases: GeneCards:  ADCY6  Malacards:  ADCY6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010977	negative regulation of neuron projection development	ISS	biological process
GO:0004016	adenylate cyclase activity	IBA	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0006171	cAMP biosynthetic process	IBA	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IBA	biological process
GO:1904322	cellular response to forskolin	IDA	biological process
GO:0006171	cAMP biosynthetic process	IDA	biological process
GO:0004016	adenylate cyclase activity	IDA	molecular function
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	biological process
GO:0004016	adenylate cyclase activity	IDA	molecular function
GO:0031226	intrinsic component of plasma membrane	ISS	cellular component
GO:1904117	cellular response to vasopressin	ISS	biological process
GO:0003091	renal water homeostasis	ISS	biological process
GO:0035811	negative regulation of urine volume	ISS	biological process
GO:0097746	regulation of blood vessel diameter	IMP	biological process
GO:0004016	adenylate cyclase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006171	cAMP biosynthetic process	IEA	biological process
GO:0009190	cyclic nucleotide biosynthetic process	IEA	biological process
GO:0016849	phosphorus-oxygen lyase activity	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006171	cAMP biosynthetic process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0004016	adenylate cyclase activity	IEA	molecular function
GO:0003091	renal water homeostasis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0007190	activation of adenylate cyclase activity	TAS	biological process
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	TAS	biological process
GO:0071377	cellular response to glucagon stimulus	TAS	biological process
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway	TAS	biological process
GO:0034199	activation of protein kinase A activity	TAS	biological process
GO:0004016	adenylate cyclase activity	IDA	molecular function
GO:0019901	protein kinase binding	ISS	molecular function
GO:0007212	dopamine receptor signaling pathway	IDA	biological process
GO:0071380	cellular response to prostaglandin E stimulus	IDA	biological process
GO:0071870	cellular response to catecholamine stimulus	IDA	biological process
GO:0006171	cAMP biosynthetic process	IDA	biological process
GO:0016020	membrane	ISS	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0032420	stereocilium	IEA	cellular component
GO:0005080	protein kinase C binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05200	Pathways in cancer
hsa04714	Thermogenesis
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa05166	Human T-cell leukemia virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04022	cGMP-PKG signaling pathway
hsa04723	Retrograde endocannabinoid signaling
hsa00230	Purine metabolism
hsa04261	Adrenergic signaling in cardiomyocytes
hsa04934	Cushing syndrome
hsa04072	Phospholipase D signaling pathway
hsa04921	Oxytocin signaling pathway
hsa04371	Apelin signaling pathway
hsa04724	Glutamatergic synapse
hsa04270	Vascular smooth muscle contraction
hsa04114	Oocyte meiosis
hsa04611	Platelet activation
hsa04926	Relaxin signaling pathway
hsa04725	Cholinergic synapse
hsa04935	Growth hormone synthesis, secretion and action
hsa04915	Estrogen signaling pathway
hsa04916	Melanogenesis
hsa05032	Morphine addiction
hsa04727	GABAergic synapse
hsa04713	Circadian entrainment
hsa04925	Aldosterone synthesis and secretion
hsa04928	Parathyroid hormone synthesis, secretion and action
hsa04972	Pancreatic secretion
hsa05414	Dilated cardiomyopathy
hsa04750	Inflammatory mediator regulation of TRP channels
hsa04970	Salivary secretion
hsa04914	Progesterone-mediated oocyte maturation
hsa04912	GnRH signaling pathway
hsa04911	Insulin secretion
hsa04540	Gap junction
hsa04211	Longevity regulating pathway
hsa01522	Endocrine resistance
hsa04971	Gastric acid secretion
hsa04918	Thyroid hormone synthesis
hsa04742	Taste transduction
hsa04924	Renin secretion
hsa04976	Bile secretion
hsa04961	Endocrine and other factor-regulated calcium reabsorption
hsa04927	Cortisol synthesis and secretion
hsa04213	Longevity regulating pathway - multiple species
hsa04923	Regulation of lipolysis in adipocytes
hsa04962	Vasopressin-regulated water reabsorption
hsa04913	Ovarian steroidogenesis

Diseases

Associated diseases	References
Lethal congenital contractural syndrome	KEGG:H00865
Lethal congenital contractural syndrome	KEGG:H00865
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq