• Gene id: 11198

Gene Summary

• Gene Symbol: SUPT16H   Gene   UCSC   Ensembl
• Aliases: CDC68, FACTP140, SPT16, SPT16/CDC68
• Gene name: SPT16 homolog, facilitates chromatin remodeling subunit
• Alternate names: FACT complex subunit SPT16, FACT 140 kDa subunit, chromatin-specific transcription elongation factor 140 kDa subunit, facilitates chromatin remodeling 140 kDa subunit, facilitates chromatin transcription complex subunit SPT16, hSPT16, suppressor of Ty 16 homolo,
• Gene location: 14q11.2 (52434370: 52424069)     Exons: 9     NC_000012.12
• Gene summary(Entrez): Transcription of protein-coding genes can be reconstituted on naked DNA with only the general transcription factors and RNA polymerase II. However, this minimal system cannot transcribe DNA packaged into chromatin, indicating that accessory factors may fa
• OMIM: 605012

Protein Summary

• Protein general information: Q9Y5B9  
  • Name: FACT complex subunit SPT16 (Chromatin specific transcription elongation factor 140 kDa subunit) (FACT 140 kDa subunit) (FACTp140) (Facilitates chromatin transcription complex subunit SPT16) (hSPT16)
  • Length: 1047  
  • Mass: 119914
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYELTDTIMVFCDDKIIF
  MASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDKMIEAIKESKNGKKIGVFSKDKFPGEFMKSW
  NDCLNKEGFDKIDISAVVAYTIAVKEDGELNLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAI
  EEKKYLAGADPSTVEMCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQE
  NYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGSLVINSKNQYKLKKGM
  VFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTSVKKKVKNVGIFLKNEDEEEEEEEKDEAEDL
  LGRGSRAALLTERTRNEMTAEEKRRAHQKELAAQLNEEAKRRLTEQKGEQQIQKARKSNVSYKNPSLMPKEPHIR
  EMKIYIDKKYETVIMPVFGIATPFHIATIKNISMSVEGDYTYLRINFYCPGSALGRNEGNIFPNPEATFVKEITY
  RASNIKAPGEQTVPALNLQNAFRIIKEVQKRYKTREAEEKEKEGIVKQDSLVINLNRSNPKLKDLYIRPNIAQKR
  MQGSLEAHVNGFRFTSVRGDKVDILYNNIKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTD
  LGKHQHMHDRDDLYAEQMEREMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSALV
  NATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIKEWLNSCDLKYTEGVQSL
  NWTKIMKTIVDDPEGFFEQGGWSFLEPEGEGSDAEEGDSESEIEDETFNPSEDDYEEEEEDSDEDYSSEAEESDY
  SKESLGSEEESGKDWDELEEEARKADRESRYEEEEEQSRSMSRKRKASVHSSGRGSNRGSRHSSAPPKKKRK

• Structural information:
  • Interpro: IPR029149  IPR036005  IPR013719  IPR029148  IPR013953   IPR000994  IPR011993  IPR040258  IPR033825  
  • CDD: cd01091
  • PDB: 4Z2M 4Z2N 5E5B 5UMT 5UMU 5XM2
  • PDBsum: 4Z2M 4Z2N 5E5B 5UMT 5UMU 5XM2
  • DIP: 42757
  • STRING: ENSP00000216297
• Other Databases: GeneCards:  SUPT16H  Malacards:  SUPT16H

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042393	histone binding	IBA	molecular function
GO:0035101	FACT complex	IBA	cellular component
GO:0032968	positive regulation of transcription elongation from RNA polymerase II promoter	IBA	biological process
GO:0034724	DNA replication-independent nucleosome organization	IBA	biological process
GO:0031491	nucleosome binding	IBA	molecular function
GO:0006368	transcription elongation from RNA polymerase II promoter	IBA	biological process
GO:0035101	FACT complex	IEA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0006260	DNA replication	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006337	nucleosome disassembly	TAS	biological process
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0032786	positive regulation of DNA-templated transcription, elongation	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881