• Gene id: 11197

Gene Summary

• Gene Symbol: WIF1   Gene   UCSC   Ensembl
• Aliases: WIF-1
• Gene name: WNT inhibitory factor 1
• Alternate names: wnt inhibitory factor 1,
• Gene location: 12q14.3 (65121304: 65050625)     Exons: 9     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene functions to inhibit WNT proteins, which are extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-li
• OMIM: 605186

Protein Summary

• Protein general information: Q9Y5W5  
  • Name: Wnt inhibitory factor 1 (WIF 1)
  • Length: 379  
  • Mass: 41528
• Sequence:

  MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQ
  RMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAF
  EVDVIVMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCV
  TPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGY
  QGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPES
  NYIW

• Structural information:
  • Protein Domains: (38..17-)
    (/note="WIF-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00222-)
    (178..21-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (211..24-)
    (/note="EGF-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU0007-)
  • Interpro: IPR013032  IPR000742  IPR003306  IPR038677  IPR013309  
  • Prosite: PS00022 PS01186 PS50026 PS50814
  • PDB: 2D3J 2YGN 2YGO 2YGP 2YGQ
  • PDBsum: 2D3J 2YGN 2YGO 2YGP 2YGQ
  • DIP: 59097
  • STRING: ENSP00000286574
• Other Databases: GeneCards:  WIF1  Malacards:  WIF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017147	Wnt-protein binding	NAS	molecular function
GO:0030178	negative regulation of Wnt signaling pathway	NAS	biological process
GO:0005576	extracellular region	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0009986	cell surface	IBA	cellular component
GO:0048856	anatomical structure development	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Cancer (small cell)	PMID:14517837
Prostate cancer	PMID:14517837
urinary bladder cancer	PMID:14517837
urinary bladder cancer	PMID:18325051
Breast cancer	PMID:16501252
nephroblastoma	PMID:16575872
invasive ductal carcinoma	PMID:14517837
renal cell carcinoma	PMID:17145819
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R