• Gene id: 11193

Gene Summary

• Gene Symbol: WBP4   Gene   UCSC   Ensembl
• Aliases: FBP21
• Gene name: WW domain binding protein 4
• Alternate names: WW domain-binding protein 4, WBP-4, WW domain-containing binding protein 4, domain-containing binding protein 4, formin binding protein 21,
• Gene location: 13q14.11 (41061508: 41084005)     Exons: 11     NC_000013.11
• Gene summary(Entrez): This gene encodes WW domain-containing binding protein 4. The WW domain represents a small and compact globular structure that interacts with proline-rich ligands. This encoded protein is a general spliceosomal protein that may play a role in cross-intron
• OMIM: 604981

Protein Summary

• Protein general information: O75554  
  • Name: WW domain binding protein 4 (WBP 4) (Formin binding protein 21) (WW domain containing binding protein 4)
  • Length: 376  
  • Mass: 42507
• Sequence:

  MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKA
  YQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYYYDLISGASQW
  EKPEGFQGDLKKTAVKTVWVEGLSEDGFTYYYNTETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDS
  HSDSDGEQEAEEGGVSTETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEI
  KQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMADGVAPVFKKRRTENGKSRNLRQRGDD
  Q

• Structural information:
  • Protein Domains: (122..15-)
    (/note="WW-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (163..19-)
    (/note="WW-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224"-)
  • Interpro: IPR000690  IPR003604  IPR013085  IPR040023  IPR001202   IPR036020  IPR036236  
  • Prosite: PS01159 PS50020 PS50171
  • CDD: cd00201
  • PDB: 2DK1 2JXW 5O9Z 6AHD
  • PDBsum: 2DK1 2JXW 5O9Z 6AHD
  • STRING: ENSP00000368801
• Other Databases: GeneCards:  WBP4  Malacards:  WBP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071011	precatalytic spliceosome	IBA	cellular component
GO:0008380	RNA splicing	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0045292	mRNA cis splicing, via spliceosome	IDA	biological process
GO:0016607	nuclear speck	IDA	cellular component
GO:0071005	U2-type precatalytic spliceosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070064	proline-rich region binding	IPI	molecular function
GO:0000398	mRNA splicing, via spliceosome	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881