• Gene id: 11186

Gene Summary

• Gene Symbol: RASSF1   Gene   UCSC   Ensembl
• Aliases: 123F2, NORE2A, RASSF1A, RDA32, REH3P21
• Gene name: Ras association domain family member 1
• Alternate names: ras association domain-containing protein 1, Ras association (RalGDS/AF-6) domain family member 1, WUGSC:H_LUCA12.5, cardiac-specific ras association domain family 1 protein, pancreas-specific ras association domain family 1 protein, tumor suppressor prot,
• Gene location: 3p21.31 (50340935: 50329785)     Exons: 9     NC_000003.12
• Gene summary(Entrez): This gene encodes a protein similar to the RAS effector proteins. Loss or altered expression of this gene has been associated with the pathogenesis of a variety of cancers, which suggests the tumor suppressor function of this gene. The inactivation of thi
• OMIM: 605082

Protein Summary

• Protein general information: Q9NS23  
  • Name: Ras association domain containing protein 1
  • Length: 344  
  • Mass: 39,219
• Sequence:

  MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPATHTWCDLCGDFIWGV
  VRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVDEPVEWETPDLSQAEIEQKIKEYNAQI
  NSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTR
  AREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAF
  SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG

• Structural information:
  • Protein Domains: Ras-associating. (198-292)
    SARAH. (294-341)
  • Interpro: IPR033614  IPR002219  IPR000159  IPR033600  IPR011524   IPR029071  
  • Prosite: PS50200 PS50951 PS50081
  • CDD: cd00029
  • PDB: 2KZU
  • PDBsum: 2KZU
  • DIP: 31270
  • STRING: ENSP00000349547
• Other Databases: GeneCards:  RASSF1  Malacards:  RASSF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000922	spindle pole	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0007050	cell cycle arrest	IMP	biological process
GO:0007265	Ras protein signal transduction	IDA	biological process
GO:0008270	zinc ion binding	TAS	molecular function
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0050821	protein stabilization	IDA	biological process
GO:0071157	negative regulation of cell cycle arrest	IDA	biological process
GO:0000922	spindle pole	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007050	cell cycle arrest	IMP	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007265	Ras protein signal transduction	IDA	biological process
GO:0008270	zinc ion binding	TAS	molecular function
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0050821	protein stabilization	IDA	biological process
GO:0071157	negative regulation of cell cycle arrest	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0007050	cell cycle arrest	IMP	biological process
GO:0007265	Ras protein signal transduction	IDA	biological process
GO:0008270	zinc ion binding	TAS	molecular function
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0050821	protein stabilization	IDA	biological process
GO:0071157	negative regulation of cell cycle arrest	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa05206	MicroRNAs in cancer
hsa05219	Bladder cancer
hsa05223	Non-small cell lung cancer

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 26162009
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Non- obstructive azoospermia	MIK: 26162009
Maturation arrest	MIK: 26162009
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26162009	Non- obstructive azoospermia, maturation arrest			80 (12 men with preserved spermatogenesis, 68 men with nonobstructive azoospermia (NOA) (40 Sertoli-cell-only syndrome (SCOS) and 28 premiotic maturation arrest (MA)))	Male infertility	USP9Y DDX3Y XKRY HSFY1 CYORF15A CYORF15B KDM5D EIF1AY RPS4Y2 RBMY1A1 PRY BPY2 DAZ1 and CDY1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq