• Gene id: 11185

Gene Summary

• Gene Symbol: INMT   Gene   UCSC   Ensembl
• Aliases: TEMT
• Gene name: indolethylamine N-methyltransferase
• Alternate names: indolethylamine N-methyltransferase, amine N-methyltransferase, aromatic alkylamine N-methyltransferase, arylamine N-methyltransferase, indolamine N-methyltransferase, nicotine N-methyltransferase, thioether S-methyltransferase,
• Gene location: 7p14.3 (30752134: 30757601)     Exons: 3     NC_000007.14
• Gene summary(Entrez): N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine. Alternative splicing results in multiple transcript variants. Read-through transcr

Protein Summary

• Protein general information: O95050  
  • Name: Indolethylamine N methyltransferase (Indolamine N methyltransferase) (EC 2.1.1.49) (EC 2.1.1.96) (Aromatic alkylamine N methyltransferase) (Amine N methyltransferase) (Arylamine N methyltransferase) (Thioether S methyltransferase) (TEMT)
  • Length: 263  
  • Mass: 28891
  • Tissue specificity: Widely expressed. The highest levels were in thyroid, adrenal gland, adult and fetal lung. Intermediate levels in heart, placenta, skeletal muscle, testis, small intestine, pancreas, stomach, spinal cord, lymph node and trachea. Very l
• Sequence:

  MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAAC
  DSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLA
  PAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAV
  LDAGFDIEQLLHSPQSYSVTNAANNGVCFIVARKKPGP

• Structural information:
  • Interpro: IPR025820  IPR000940  IPR029063  
  • Prosite: PS01100 PS51681
  • PDB: 2A14
  • PDBsum: 2A14
  • STRING: ENSP00000013222
• Other Databases: GeneCards:  INMT  Malacards:  INMT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0008170	N-methyltransferase activity	IBA	molecular function
GO:0030748	amine N-methyltransferase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0032259	methylation	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0030748	amine N-methyltransferase activity	IDA	molecular function
GO:0009308	amine metabolic process	IDA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0102707	S-adenosyl-L-methionine:beta-alanine N-methyltransferase activity	IEA	molecular function
GO:0030748	amine N-methyltransferase activity	IEA	molecular function
GO:0004790	thioether S-methyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00380	Tryptophan metabolism
hsa00450	Selenocompound metabolism

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray