• Gene id: 11181

Gene Summary

• Gene Symbol: TREH   Gene   UCSC   Ensembl
• Aliases: TRE, TREA, TREHD
• Gene name: trehalase
• Alternate names: trehalase, alpha,alpha-trehalose glucohydrolase, trehalase (brush-border membrane glycoprotein),
• Gene location: 11q23.3 (118679649: 118657315)     Exons: 15     NC_000011.10
• Gene summary(Entrez): This gene encodes an enzyme that hydrolyses trehalose, a disaccharide formed from two glucose molecules found mainly in fungi, plants, and insects. A partial duplication of this gene is located adjacent to this locus on chromosome 11. Two transcript varia
• OMIM: 275360

Protein Summary

• Protein general information: O43280  
  • Name: Trehalase (EC 3.2.1.28) (Alpha,alpha trehalase) (Alpha,alpha trehalose glucohydrolase)
  • Length: 583  
  • Mass: 66568
  • Tissue specificity: Expressed in kidney, liver and small intestine. Also more weakly expressed in pancreas. {ECO
• Sequence:

  MPGRTWELCLLLLLGLGLGSQEALPPPCESEIYCHGELLNQVQMAKLYQDDKQFVDMPLSIAPEQVLQTFTELSR
  DHNHSIPREQLQAFVHEHFQAKGQELQPWTPADWKDSPQFLQKISDAKLRAWAGQLHQLWKKLGKKMKPEVLSHP
  ERFSLIYSEHPFIVPGGRFVEFYYWDSYWVMEGLLLSEMAETVKGMLQNFLDLVKTYGHVPNGGRVYYLQRSQPP
  LLTLMMDCYLTHTNDTAFLQENIETLALELDFWTKNRTVSVSLEGKNYLLNRYYVPYGGPRPESYSKDVELADTL
  PEGDREALWAELKAGAESGWDFSSRWLIGGPNPNSLSGIRTSKLVPVDLNAFLCQAEELMSNFYSRLGNDSQATK
  YRILRSQRLAALNTVLWDEQTGAWFDYDLEKKKKNREFYPSNLTPLWAGCFSDPGVADKALKYLEDNRILTYQYG
  IPTSLQKTGQQWDFPNAWAPLQDLVIRGLAKAPLRRAQEVAFQLAQNWIRTNFDVYSQKSAMYEKYDVSNGGQPG
  GGGEYEVQEGFGWTNGVVLMLLDRYGDRLTSGAKLAFLEPHCLAATLLPSLLLSLLPW

• Structural information:
  • Interpro: IPR008928  IPR012341  IPR001661  IPR018232  
  • Prosite: PS00927 PS00928
  • STRING: ENSP00000264029
• Other Databases: GeneCards:  TREH  Malacards:  TREH

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005993	trehalose catabolic process	IDA	biological process
GO:0004555	alpha,alpha-trehalase activity	IDA	molecular function
GO:0031225	anchored component of membrane	ISS	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0004555	alpha,alpha-trehalase activity	IEA	molecular function
GO:0005991	trehalose metabolic process	IEA	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016798	hydrolase activity, acting on glycosyl bonds	IEA	molecular function
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0004555	alpha,alpha-trehalase activity	IEA	molecular function
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004555	alpha,alpha-trehalase activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005991	trehalose metabolic process	NAS	biological process
GO:0046658	anchored component of plasma membrane	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00500	Starch and sucrose metabolism

Diseases

Associated diseases	References
Trehalase deficiency	KEGG:H02090
Trehalase deficiency	KEGG:H02090
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)