• Gene id: 11171

Gene Summary

• Gene Symbol: STRAP   Gene   UCSC   Ensembl
• Aliases: MAWD, PT-WD, UNRIP
• Gene name: serine/threonine kinase receptor associated protein
• Alternate names: serine-threonine kinase receptor-associated protein, MAP activator with WD repeats, MAPK activator with WD repeats, WD-40 repeat protein PT-WD, mitogen-activated protein kinase activator with WD repeats, unr-interacting protein,
• Gene location: 12p12.3 (15882381: 15903477)     Exons: 10     NC_000012.12
• OMIM: 605986

Protein Summary

• Protein general information: Q9Y3F4  
  • Name: Serine threonine kinase receptor associated protein (MAP activator with WD repeats) (UNR interacting protein) (WD 40 repeat protein PT WD)
  • Length: 350  
  • Mass: 38438
• Sequence:

  MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKDATKAA
  TAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL
  WCSEDKQILSADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGEILVITYGRSIAFHSAVSLDPIKSFEAPAT
  INSASLHPEKEFLVAGGEDFKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKTY
  GLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA

• Structural information:
  • Interpro: IPR020472  IPR015943  IPR001680  IPR019775  IPR017986   IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000392270
• Other Databases: GeneCards:  STRAP  Malacards:  STRAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000387	spliceosomal snRNP assembly	IBA	biological process
GO:0032797	SMN complex	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0034719	SMN-Sm protein complex	IBA	cellular component
GO:0032797	SMN complex	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000387	spliceosomal snRNP assembly	IDA	biological process
GO:0034719	SMN-Sm protein complex	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0060394	negative regulation of pathway-restricted SMAD protein phosphorylation	IMP	biological process
GO:0050680	negative regulation of epithelial cell proliferation	IMP	biological process
GO:0010719	negative regulation of epithelial to mesenchymal transition	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IMP	biological process
GO:0030277	maintenance of gastrointestinal epithelium	IMP	biological process
GO:0010633	negative regulation of epithelial cell migration	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
colorectal carcinoma	PMID:16778189
Adenocarcinoma	PMID:16778189
Squamous cell neoplasm	PMID:16778189
lung carcinoma	PMID:16778189
large cell carcinoma	PMID:16778189
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)