• Gene id: 11170

Gene Summary

• Gene Symbol: FAM107A   Gene   UCSC   Ensembl
• Aliases: DRR1, TU3A
• Gene name: family with sequence similarity 107 member A
• Alternate names: actin-associated protein FAM107A, down-regulated in renal cell carcinoma 1, protein FAM107A,
• Gene location: 3p14.3-p14.2 (58627609: 58564116)     Exons: 8     NC_000003.12

Protein Summary

• Protein general information: O95990  
  • Name: Actin associated protein FAM107A (Down regulated in renal cell carcinoma 1) (Protein TU3A)
  • Length: 144  
  • Mass: 17455
  • Tissue specificity: Widely expressed (PubMed
• Sequence:

  MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRR
  RNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL

• Structural information:
  • Interpro: IPR009533  
  • STRING: ENSP00000419124
• Other Databases: GeneCards:  FAM107A  Malacards:  FAM107A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001725	stress fiber	IBA	cellular component
GO:0032956	regulation of actin cytoskeleton organization	IBA	biological process
GO:0045202	synapse	IBA	cellular component
GO:0051017	actin filament bundle assembly	IBA	biological process
GO:0030041	actin filament polymerization	IBA	biological process
GO:0043005	neuron projection	IBA	cellular component
GO:0032587	ruffle membrane	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0001725	stress fiber	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0043005	neuron projection	ISS	cellular component
GO:0043005	neuron projection	ISS	cellular component
GO:0015629	actin cytoskeleton	ISS	cellular component
GO:0051895	negative regulation of focal adhesion assembly	IMP	biological process
GO:0030041	actin filament polymerization	ISS	biological process
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0045202	synapse	ISS	cellular component
GO:1900272	negative regulation of long-term synaptic potentiation	ISS	biological process
GO:0071385	cellular response to glucocorticoid stimulus	ISS	biological process
GO:0050890	cognition	ISS	biological process
GO:0031669	cellular response to nutrient levels	ISS	biological process
GO:0070507	regulation of microtubule cytoskeleton organization	IMP	biological process
GO:0032956	regulation of actin cytoskeleton organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051017	actin filament bundle assembly	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031398	positive regulation of protein ubiquitination	IMP	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0040008	regulation of growth	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0030041	actin filament polymerization	IEA	biological process
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:1900272	negative regulation of long-term synaptic potentiation	IEA	biological process
GO:0071385	cellular response to glucocorticoid stimulus	IEA	biological process
GO:0051017	actin filament bundle assembly	IEA	biological process
GO:0050890	cognition	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0031669	cellular response to nutrient levels	IEA	biological process
GO:0032587	ruffle membrane	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0001558	regulation of cell growth	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray