• Gene id: 1117

Gene Summary

• Gene Symbol: CHI3L2   Gene   UCSC   Ensembl
• Aliases: CHIL2, YKL-39, YKL39
• Gene name: chitinase 3 like 2
• Alternate names: chitinase-3-like protein 2, chondrocyte protein 39,
• Gene location: 1p13.2 (111227079: 111243439)     Exons: 12     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is similar to bacterial chitinases but lacks chitinase activity. The encoded protein is secreted and is involved in cartilage biogenesis. Several transcript variants encoding different isoforms have been found for this gen
• OMIM: 601114

Protein Summary

• Protein general information: Q15782  
  • Name: Chitinase 3 like protein 2 (Chondrocyte protein 39) (YKL 39)
  • Length: 390  
  • Mass: 43501
  • Tissue specificity: Highest expression in chondrocytes, followed by synoviocytes, lung and heart. Not detected in spleen, pancreas, and liver. May also be expressed in developing brain and placenta. {ECO
• Sequence:

  MGATTMDQKSLWAGVVVLLLLQGGSAYKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKD
  KSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQK
  ENTHFTVLIHELAEAFQKDFTKSTKERLLLTAGVSAGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEKPLITG
  HNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAETTVGAPASGPGAAGPITESSG
  FLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLKNLNLGGAMIWSIDMDDFTGKSCNQG
  PYPLVQAVKRSLGSL

• Structural information:
  • Protein Domains: (27..39-)
    (/note="GH18-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01258"-)
  • Interpro: IPR028541  IPR011583  IPR029070  IPR001223  IPR017853  
  • Prosite: PS51910
  • PDB: 4AY1 4P8U 4P8V 4P8W 4P8X
  • PDBsum: 4AY1 4P8U 4P8V 4P8W 4P8X
  • STRING: ENSP00000437082
• Other Databases: GeneCards:  CHI3L2  Malacards:  CHI3L2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004568	chitinase activity	IBA	NOT|molecular function
GO:0006032	chitin catabolic process	IBA	biological process
GO:0005576	extracellular region	IBA	cellular component
GO:0008061	chitin binding	IBA	molecular function
GO:0008061	chitin binding	IDA	molecular function
GO:0004568	chitinase activity	IDA	NOT|molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008061	chitin binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008061	chitin binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0004568	chitinase activity	IBA	NOT|molecular function
GO:0006032	chitin catabolic process	IBA	biological process
GO:0005576	extracellular region	IBA	cellular component
GO:0008061	chitin binding	IBA	molecular function
GO:0008061	chitin binding	IDA	molecular function
GO:0004568	chitinase activity	IDA	NOT|molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0008061	chitin binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008061	chitin binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray