• Gene id: 11168

Gene Summary

• Gene Symbol: PSIP1   Gene   UCSC   Ensembl
• Aliases: DFS70, LEDGF, PAIP, PSIP2, p52, p75
• Gene name: PC4 and SFRS1 interacting protein 1
• Alternate names: PC4 and SFRS1-interacting protein, CLL-associated antigen KW-7, dense fine speckles 70 kDa protein, lens epithelium-derived growth factor, transcriptional coactivator p52/p75,
• Gene location: 9p22.3 (15511018: 15464065)     Exons: 17     NC_000009.12
• OMIM: 603620

Protein Summary

• Protein general information: O75475  
  • Name: PC4 and SFRS1 interacting protein (CLL associated antigen KW 7) (Dense fine speckles 70 kDa protein) (DFS 70) (Lens epithelium derived growth factor) (Transcriptional coactivator p75/p52)
  • Length: 530  
  • Mass: 60103
  • Tissue specificity: Widely expressed. Expressed at high level in the thymus. Expressed in fetal and adult brain. Expressed in neurons, but not astrocytes. Markedly elevated in fetal as compared to adult brain. In the adult brain, expressed in the subventr
• Sequence:

  MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRK
  GFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRK
  RKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEK
  QPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRR
  NMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIKNSLKIDNLDVNRCIE
  ALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVGEGDSVITQVLNKSLAEQRQH
  EEANKTKDQGKKGPNKKLEKEQTGSKTLNGGSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKD
  STLDN

• Structural information:
  • Protein Domains: (1..6-)
    (/note="PWWP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00162"-)
  • Interpro: IPR035496  IPR036218  IPR021567  IPR000313  IPR035441  
  • Prosite: PS50812
  • CDD: cd05834
  • PDB: 1Z9E 2B4J 2M16 2MSR 2MTN 2N3A 3F9K 3HPG 3HPH 3U88 3ZEH 4FU6 5N88 5OYM 5YI9 6EMO 6EMP 6EMQ 6EMR 6S01
  • PDBsum: 1Z9E 2B4J 2M16 2MSR 2MTN 2N3A 3F9K 3HPG 3HPH 3U88 3ZEH 4FU6 5N88 5OYM 5YI9 6EMO 6EMP 6EMQ 6EMR 6S01
  • DIP: 46656
  • STRING: ENSP00000370109
• Other Databases: GeneCards:  PSIP1  Malacards:  PSIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051169	nuclear transport	TAS	biological process
GO:0075713	establishment of integrated proviral latency	TAS	biological process
GO:0075713	establishment of integrated proviral latency	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009408	response to heat	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0000395	mRNA 5'-splice site recognition	IDA	biological process
GO:0035327	transcriptionally active chromatin	ISS	cellular component
GO:0009408	response to heat	ISS	biological process
GO:0097100	supercoiled DNA binding	ISS	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0006979	response to oxidative stress	ISS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)