• Gene id: 11167

Gene Summary

• Gene Symbol: FSTL1   Gene   UCSC   Ensembl
• Aliases: FRP, FSL1, MIR198, OCC-1, OCC1, tsc36
• Gene name: follistatin like 1
• Alternate names: follistatin-related protein 1, follistatin-like protein 1,
• Gene location: 3q13.33 (93974080: 93873036)     Exons: 16     NC_000003.12
• Gene summary(Entrez): This gene encodes a protein with similarity to follistatin, an activin-binding protein. It contains an FS module, a follistatin-like sequence containing 10 conserved cysteine residues. This gene product is thought to be an autoantigen associated with rheu
• OMIM: 605547

Protein Summary

• Protein general information: Q12841  
  • Name: Follistatin related protein 1 (Follistatin like protein 1)
  • Length: 308  
  • Mass: 34986
  • Tissue specificity: Overexpressed in synovial tissues from rheumatoid arthritis. {ECO
• Sequence:

  MWKRWLALALALVAVAWVRAEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPHKRPVCGSNGKTYLN
  HCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDELRRRIIQWLEAEIIPDGWFSKGSNYSEILD
  KYFKNFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPS
  FNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKT
  KRVSTKEI

• Structural information:
  • Protein Domains: (30..5-)
    (/note="Follistatin-like-)
    (48..10-)
    (/note="Kazal-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798-)
    (144..17-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (193..22-)
    (/note="EF-hand-2)
    (-)
  • Interpro: IPR011992  IPR002048  IPR003645  IPR015369  IPR002350   IPR036058  IPR036773  
  • Prosite: PS50222 PS51465
  • STRING: ENSP00000295633
• Other Databases: GeneCards:  FSTL1  Malacards:  FSTL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030154	cell differentiation	IBA	biological process
GO:0030510	regulation of BMP signaling pathway	IBA	biological process
GO:0007275	multicellular organism development	IBA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0008201	heparin binding	TAS	molecular function
GO:0005615	extracellular space	TAS	cellular component
GO:0030509	BMP signaling pathway	TAS	biological process
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042594	response to starvation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881