• Gene id: 11166

Gene Summary

• Gene Symbol: SOX21   Gene   UCSC   Ensembl
• Aliases: SOX25
• Gene name: SRY-box transcription factor 21
• Alternate names: transcription factor SOX-21, SOX-A, SRY (sex determining region Y)-box 21, SRY-box 21,
• Gene location: 13q32.1 (94712544: 94709621)     Exons: 1     NC_000013.11
• Gene summary(Entrez): SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are d
• OMIM: 300637

Protein Summary

• Protein general information: Q9Y651  
  • Name: Transcription factor SOX 21 (SOX A)
  • Length: 276  
  • Mass: 28580
• Sequence:

  MSKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMKEHPDY
  KYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKAAAAAAAAAARVFF
  PQSAAAAAAAAAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTAGAGAFHGAAAAAAAAAAAAGGHTHS
  HPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQLDPYPAAYAAAL

• Structural information:
  • Interpro: IPR009071  IPR036910  IPR022097  
  • Prosite: PS50118
  • STRING: ENSP00000366144
• Other Databases: GeneCards:  SOX21  Malacards:  SOX21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0009653	anatomical structure morphogenesis	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0042633	hair cycle	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0001942	hair follicle development	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043588	skin development	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0048863	stem cell differentiation	IDA	biological process
GO:0006355	regulation of transcription, DNA-templated	ISS	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003677	DNA binding	ISS	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	NAS	biological process
GO:0003700	DNA-binding transcription factor activity	ISS	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881