• Gene id: 11165

Gene Summary

• Gene Symbol: NUDT3   Gene   UCSC   Ensembl
• Aliases: DIPP, DIPP-1, DIPP1
• Gene name: nudix hydrolase 3
• Alternate names: diphosphoinositol polyphosphate phosphohydrolase 1, diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1, nucleoside diphosphate-linked moiety X motif 3, nudix (nucleoside diphosphate linked moiety X)-type motif 3, nudix motif 3,
• Gene location: 6p21.31 (34392668: 34279678)     Exons: 5     NC_000006.12
• Gene summary(Entrez): NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, wh

Protein Summary

• Protein general information: O95989  
  • Name: Diphosphoinositol polyphosphate phosphohydrolase 1 (DIPP 1) (EC 3.6.1.52) (Diadenosine 5',5''' P1,P6 hexaphosphate hydrolase 1) (EC 3.6.1. ) (Nucleoside diphosphate linked moiety X motif 3) (Nudix motif 3)
  • Length: 172  
  • Mass: 19471
  • Tissue specificity: Widely expressed. Expressed at higher level in brain, heart, pancreas and liver. Also expressed in placenta, lung and kidney. {ECO
• Sequence:

  MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKG
  TLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSAN
  NGTPVVATTYSVSAQSSMSGIR

• Structural information:
  • Protein Domains: (17..14-)
    (/note="Nudix-hydrolase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00794"-)
  • Interpro: IPR015797  IPR020084  IPR000086  
  • Prosite: PS51462 PS00893
  • PDB: 2FVV 2Q9P
  • PDBsum: 2FVV 2Q9P
  • STRING: ENSP00000476119
• Other Databases: GeneCards:  NUDT3  Malacards:  NUDT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050072	m7G(5')pppN diphosphatase activity	IBA	molecular function
GO:0071543	diphosphoinositol polyphosphate metabolic process	IBA	biological process
GO:1901907	diadenosine pentaphosphate catabolic process	IBA	biological process
GO:1901911	adenosine 5'-(hexahydrogen pentaphosphate) catabolic process	IBA	biological process
GO:0000298	endopolyphosphatase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008486	diphosphoinositol-polyphosphate diphosphatase activity	IBA	molecular function
GO:0034431	bis(5'-adenosyl)-hexaphosphatase activity	IBA	molecular function
GO:0034432	bis(5'-adenosyl)-pentaphosphatase activity	IBA	molecular function
GO:1901909	diadenosine hexaphosphate catabolic process	IBA	biological process
GO:0071544	diphosphoinositol polyphosphate catabolic process	IDA	biological process
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0008486	diphosphoinositol-polyphosphate diphosphatase activity	IDA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0008486	diphosphoinositol-polyphosphate diphosphatase activity	TAS	molecular function
GO:0015961	diadenosine polyphosphate catabolic process	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0052840	inositol diphosphate tetrakisphosphate diphosphatase activity	IEA	molecular function
GO:0052842	inositol diphosphate pentakisphosphate diphosphatase activity	IEA	molecular function
GO:0008486	diphosphoinositol-polyphosphate diphosphatase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881