• Gene id: 11163

Gene Summary

• Gene Symbol: NUDT4   Gene   UCSC   Ensembl
• Aliases: DIPP-2B, DIPP2, DIPP2alpha, DIPP2beta, HDCMB47P, NUDT4B
• Gene name: nudix hydrolase 4
• Alternate names: diphosphoinositol polyphosphate phosphohydrolase 2, DIPP-2, Diphosphoinositol polyphosphate phosphohydrolase NUDT4B, Nucleoside diphosphate-linked moiety X motif 4B, Nudix hydrolase 4B, Nudix motif 4B, diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 2, diphosp,
• Gene location: 12q22 (30447240: 30644224)     Exons: 11     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene regulates the turnover of diphosphoinositol polyphosphates. The turnover of these high-energy diphosphoinositol polyphosphates represents a molecular switching activity with important regulatory consequences. Molecular swi
• OMIM: 609229

Protein Summary

• Protein general information: A0A024RBG1  
  • Name: Diphosphoinositol polyphosphate phosphohydrolase NUDT4B (DIPP 2B) (EC 3.6.1.52) (Nucleoside diphosphate linked moiety X motif 4B) (Nudix motif 4B) (Nudix hydrolase 4B)
  • Length: 181  
  • Mass: 20434
• Sequence:

  MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKG
  KLGRLLGIFEQNQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSP
  ANGNSTVPSLPDNNALFVTAAQTSGLPSSVR

• Structural information:
  • Protein Domains: (18..14-)
    (/note="Nudix-hydrolase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00794"-)
  • Interpro: IPR015797  IPR020084  IPR000086  
  • Prosite: PS51462 PS00893
• Other Databases: GeneCards:  NUDT4  Malacards:  NUDT4
• Protein general information: Q9NZJ9  
  
  Name: Diphosphoinositol polyphosphate phosphohydrolase 2 (DIPP 2) (EC 3.6.1.52) (Diadenosine 5',5''' P1,P6 hexaphosphate hydrolase 2) (Nucleoside diphosphate linked moiety X motif 4) (Nudix motif 4)
  
  Length: 180  Mass: 20306
  
  Tissue specificity: Expressed in heart and, at lower level in skeletal muscle, pancreas and kidney. {ECO
• Sequence: MMKFKPNQTRTYDREGFKKRAACLCFRSEQEDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKG
  KLGRLLGIFENQDRKHRTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPA
  NGNSTVPSLPDNNALFVTAAQTSGLPSSVR
• Structural information:

  Protein Domains	(18..14-) (/note="Nudix-hydrolase) (/evidence="ECO:0000255|PROSITE-ProRule:PRU00794"-)
  Interpro:	IPR015797  IPR020084  IPR000086
  Prosite:	PS51462 PS00893
  PDB:	5LTU
  PDBsum:	5LTU
  STRING:	ENSP00000338352

• Other Databases: GeneCards:  NUDT4  Malacards:  NUDT4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0052840	inositol diphosphate tetrakisphosphate diphosphatase activity	IEA	molecular function
GO:0008486	diphosphoinositol-polyphosphate diphosphatase activity	IEA	molecular function
GO:0052842	inositol diphosphate pentakisphosphate diphosphatase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0050072	m7G(5')pppN diphosphatase activity	IBA	molecular function
GO:0071543	diphosphoinositol polyphosphate metabolic process	IBA	biological process
GO:1901907	diadenosine pentaphosphate catabolic process	IBA	biological process
GO:1901911	adenosine 5'-(hexahydrogen pentaphosphate) catabolic process	IBA	biological process
GO:0000298	endopolyphosphatase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008486	diphosphoinositol-polyphosphate diphosphatase activity	IBA	molecular function
GO:0034431	bis(5'-adenosyl)-hexaphosphatase activity	IBA	molecular function
GO:0034432	bis(5'-adenosyl)-pentaphosphatase activity	IBA	molecular function
GO:1901909	diadenosine hexaphosphate catabolic process	IBA	biological process
GO:0050072	m7G(5')pppN diphosphatase activity	ISS	NOT|molecular function
GO:0030515	snoRNA binding	ISS	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0008486	diphosphoinositol-polyphosphate diphosphatase activity	TAS	molecular function
GO:0008486	diphosphoinositol-polyphosphate diphosphatase activity	IEA	molecular function
GO:0052840	inositol diphosphate tetrakisphosphate diphosphatase activity	IEA	molecular function
GO:0052842	inositol diphosphate pentakisphosphate diphosphatase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043647	inositol phosphate metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0008486	diphosphoinositol-polyphosphate diphosphatase activity	IDA	molecular function
GO:0019935	cyclic-nucleotide-mediated signaling	TAS	biological process
GO:0035556	intracellular signal transduction	NAS	biological process
GO:0019722	calcium-mediated signaling	TAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)