• Gene id: 11162

Gene Summary

• Gene Symbol: NUDT6   Gene   UCSC   Ensembl
• Aliases: ASFGF2, FGF-AS, FGF2AS, GFG-1, GFG1
• Gene name: nudix hydrolase 6
• Alternate names: nucleoside diphosphate-linked moiety X motif 6, antisense basic fibroblast growth factor, nudix (nucleoside diphosphate linked moiety X)-type motif 6,
• Gene location: 4q28.1 (122922967: 122892576)     Exons: 10     NC_000004.12
• Gene summary(Entrez): This gene overlaps and lies on the opposite strand from FGF2 gene, and is thought to be the FGF2 antisense gene. The two genes are independently transcribed, and their expression shows an inverse relationship, suggesting that this antisense transcript may
• OMIM: 606261

Protein Summary

• Protein general information: P53370  
  • Name: Nucleoside diphosphate linked moiety X motif 6 (Nudix motif 6) (EC 3.6.1. ) (Antisense basic fibroblast growth factor) (Protein GFG)
  • Length: 316  
  • Mass: 35679
  • Tissue specificity: Detected in liver, kidney and esophagus (at protein level). Ubiquitous. {ECO
• Sequence:

  MRQPLSWGRWRAMLARTYGPGPSAGYRWASGAQGYVRNPPVGACDLQGELDRFGGISVRLARLDALDRLDAAAFQ
  KGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAESDSSTLTLWLREGPSRLPGYASHQVGVAGAV
  FDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGDTAVREVFEETGIKSEFRSVLSIRQQHTNPGAFGKSDMYI
  ICRLKPYSFTINFCQEECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFDKIDLTVEELPAVYTGLFYKL
  YHKELPENYKTMKGID

• Structural information:
  • Protein Domains: (141..27-)
    (/note="Nudix-hydrolase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00794"-)
  • Interpro: IPR015797  IPR003293  IPR020084  IPR000086  IPR040618  
  • Prosite: PS51462 PS00893
  • PDB: 3FXT 3H95
  • PDBsum: 3FXT 3H95
  • STRING: ENSP00000306070
• Other Databases: GeneCards:  NUDT6  Malacards:  NUDT6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0047631	ADP-ribose diphosphatase activity	IBA	molecular function
GO:0007165	signal transduction	IBA	biological process
GO:0051287	NAD binding	IBA	molecular function
GO:0035529	NADH pyrophosphatase activity	IBA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0045786	negative regulation of cell cycle	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0008285	negative regulation of cell population proliferation	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881