• Gene id: 11157

Gene Summary

• Gene Symbol: LSM6   Gene   UCSC   Ensembl
• Aliases: YDR378C
• Gene name: LSM6 homolog, U6 small nuclear RNA and mRNA degradation associated
• Alternate names: U6 snRNA-associated Sm-like protein LSm6, LSM6 U6 small nuclear RNA and mRNA degradation associated, LSM6 homolog, U6 small nuclear RNA associated, Sm protein F,
• Gene location: 4q31.22 (146175702: 146204435)     Exons: 8     NC_000004.12
• Gene summary(Entrez): Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length
• OMIM: 607286

Protein Summary

• Protein general information: P62312  
  • Name: U6 snRNA associated Sm like protein LSm6
  • Length: 80  
  • Mass: 9128
• Sequence:

  MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYIST
  QKRRM

• Structural information:
  • Interpro: IPR016487  IPR001163  IPR010920  
  • PDB: 3JCR 5O9Z 6AH0 6AHD 6QW6 6QX9
  • PDBsum: 3JCR 5O9Z 6AH0 6AHD 6QW6 6QX9
  • DIP: 31128
  • STRING: ENSP00000422392
• Other Databases: GeneCards:  LSM6  Malacards:  LSM6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IBA	molecular function
GO:0005732	small nucleolar ribonucleoprotein complex	IBA	cellular component
GO:0030490	maturation of SSU-rRNA	IBA	biological process
GO:0046540	U4/U6 x U5 tri-snRNP complex	IBA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IBA	biological process
GO:0000932	P-body	IBA	cellular component
GO:0005688	U6 snRNP	IBA	cellular component
GO:0005730	nucleolus	IBA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0120115	Lsm2-8 complex	IDA	cellular component
GO:0071005	U2-type precatalytic spliceosome	IDA	cellular component
GO:0046540	U4/U6 x U5 tri-snRNP complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000398	mRNA splicing, via spliceosome	IEA	biological process
GO:0005732	small nucleolar ribonucleoprotein complex	IEA	cellular component
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0008033	tRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0006364	rRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0046982	protein heterodimerization activity	IDA	molecular function
GO:0006402	mRNA catabolic process	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	TAS	biological process
GO:0030532	small nuclear ribonucleoprotein complex	TAS	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome
hsa03018	RNA degradation

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)