• Gene id: 11156

Gene Summary

• Gene Symbol: PTP4A3   Gene   UCSC   Ensembl
• Aliases: PRL-3, PRL-R, PRL3
• Gene name: protein tyrosine phosphatase 4A3
• Alternate names: protein tyrosine phosphatase type IVA 3, phosphatase of regenerating liver 3, potentially prenylated protein tyrosine phosphatase, protein tyrosine phosphatase type IVA, member 3, protein-tyrosine phosphatase of regenerating liver 3,
• Gene location: 8q24.3 (141391994: 141432453)     Exons: 10     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the protein-tyrosine phosphatase family. Protein tyrosine phosphatases are cell signaling molecules that play regulatory roles in a variety of cellular processes. Studies of this class of protein tyrosine phosphatase in mice
• OMIM: 611564

Protein Summary

• Protein general information: O75365  
  • Name: Protein tyrosine phosphatase type IVA 3 (EC 3.1.3.48) (PRL R) (Protein tyrosine phosphatase 4a3) (Protein tyrosine phosphatase of regenerating liver 3) (PRL 3)
  • Length: 173  
  • Mass: 19535
  • Tissue specificity: Mainly expressed in cardiomyocytes and skeletal muscle; also found in pancreas. Consistently overexpressed in colon cancer metastasis. {ECO
• Sequence:

  MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAP
  PPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLE
  KYRPKQRLRFKDPHTHKTRCCVM

• Structural information:
  • Protein Domains: (82..14-)
    (/note="Tyrosine-protein-phosphatase")
  • Interpro: IPR000340  IPR029021  IPR003595  IPR000387  
  • Prosite: PS50056
  • PDB: 1R6H 1V3A 2MBC 5TSR
  • PDBsum: 1R6H 1V3A 2MBC 5TSR
  • STRING: ENSP00000332274
• Other Databases: GeneCards:  PTP4A3  Malacards:  PTP4A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043542	endothelial cell migration	IBA	biological process
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0008138	protein tyrosine/serine/threonine phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004727	prenylated protein tyrosine phosphatase activity	TAS	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0043542	endothelial cell migration	IMP	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0043117	positive regulation of vascular permeability	IEA	biological process
GO:0043542	endothelial cell migration	IEA	biological process
GO:1900746	regulation of vascular endothelial growth factor signaling pathway	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0005769	early endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:1901224	positive regulation of NIK/NF-kappaB signaling	IDA	biological process
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0005737	cytoplasm	IMP	cellular component
GO:1904951	positive regulation of establishment of protein localization	IMP	biological process
GO:0005634	nucleus	IMP	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq