About Us

Search Result


Gene id 11154
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol AP4S1   Gene   UCSC   Ensembl
Aliases AP47B, CLA20, CLAPS4, CPSQ6, SPG52
Gene name adaptor related protein complex 4 subunit sigma 1
Alternate names AP-4 complex subunit sigma-1, AP-4 adapter complex subunit sigma-1, AP-4 adaptor complex subunit sigma-1, adaptor related protein complex 4 sigma 1 subunit, clathrin-associated/assembly/adaptor protein, sigma 4, sigma-4-adaptin,
Gene location 14q12 (31025105: 31096449)     Exons: 11     NC_000014.9
Gene summary(Entrez) This gene encodes a member of the adaptor complexes small subunit protein family. These proteins are components of the heterotetrameric adaptor protein complexes, which play important roles in the secretory and endocytic pathways by mediating vesicle form
OMIM 0

Protein Summary

Protein general information Q9Y587  

Name: AP 4 complex subunit sigma 1 (AP 4 adaptor complex subunit sigma 1) (Adaptor related protein complex 4 subunit sigma 1) (Sigma 1 subunit of AP 4) (Sigma 4 adaptin) (Sigma4 adaptin)

Length: 144  Mass: 17005

Tissue specificity: Widely expressed.

Sequence MIKFFLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYRQYAALFIVVGVNDTE
NEMAIYEFIHNFVEVLDEYFSRVSELDIMFNLDKVHIILDEMVLNGCIVETNRARILAPLLILDKMSES
Structural information
Interpro:  IPR016635  IPR022775  IPR011012  
MINT:  
STRING:   ENSP00000216366
Other Databases GeneCards:  AP4S1  Malacards:  AP4S1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0016192 vesicle-mediated transpor
t
IBA biological process
GO:0043231 intracellular membrane-bo
unded organelle
IBA cellular component
GO:0006605 protein targeting
IC biological process
GO:0008104 protein localization
IC biological process
GO:0030124 AP-4 adaptor complex
IDA cellular component
GO:0015031 protein transport
IEA biological process
GO:0005794 Golgi apparatus
IEA cellular component
GO:0015031 protein transport
IEA biological process
GO:0016020 membrane
IEA cellular component
GO:0031904 endosome lumen
TAS cellular component
GO:0032588 trans-Golgi network membr
ane
TAS cellular component
GO:0032588 trans-Golgi network membr
ane
TAS cellular component
GO:0005794 Golgi apparatus
IEA cellular component
GO:0043231 intracellular membrane-bo
unded organelle
IDA cellular component

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04142Lysosome
Associated diseases References
Hereditary spastic paraplegia KEGG:H00266
Hereditary spastic paraplegia KEGG:H00266
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Teratozoospermia MIK: 17327269
Unexplained infertility MIK: 25753583

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract
25753583 Unexplaine
d infertil
ity

46 (17 fertile
men, 29 male pa
tients)
Male infertility Microarray
Show abstract