• Gene id: 11151

Gene Summary

• Gene Symbol: CORO1A   Gene   UCSC   Ensembl
• Aliases: CLABP, CLIPINA, HCORO1, IMD8, TACO, p57
• Gene name: coronin 1A
• Alternate names: coronin-1A, clipin-A, coronin, actin binding protein, 1A, coronin-1, coronin-like protein A, coronin-like protein p57, tryptophan aspartate-containing coat protein,
• Gene location: 16p11.2 (30183409: 30189075)     Exons: 12     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com

Protein Summary

• Protein general information: P31146  
  • Name: Coronin 1A (Coronin like protein A) (Clipin A) (Coronin like protein p57) (Tryptophan aspartate containing coat protein) (TACO)
  • Length: 461  
  • Mass: 51026
  • Tissue specificity: Expressed in brain, thymus, spleen, bone marrow and lymph node. Low in lung and gut.
• Sequence:

  MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRVDKNAP
  TVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSA
  GCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVR
  AVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSE
  APFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQEDLYPPTAGPDPALT
  AEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKR
  LDRLEETVQAK

• Structural information:
  • Interpro: IPR029508  IPR015505  IPR015048  IPR015049  IPR015943   IPR001680  IPR019775  IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000219150
• Other Databases: GeneCards:  CORO1A  Malacards:  CORO1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0051015	actin filament binding	IBA	molecular function
GO:0016477	cell migration	IBA	biological process
GO:0007015	actin filament organization	IBA	biological process
GO:0001845	phagolysosome assembly	IEA	biological process
GO:0051015	actin filament binding	IEA	molecular function
GO:0030595	leukocyte chemotaxis	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071353	cellular response to interleukin-4	IEA	biological process
GO:0061502	early endosome to recycling endosome transport	IEA	biological process
GO:0051279	regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0050870	positive regulation of T cell activation	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0038180	nerve growth factor signaling pathway	IEA	biological process
GO:0032796	uropod organization	IEA	biological process
GO:0031252	cell leading edge	IEA	cellular component
GO:0030833	regulation of actin filament polymerization	IEA	biological process
GO:0030595	leukocyte chemotaxis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0051015	actin filament binding	IEA	molecular function
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological process
GO:0043029	T cell homeostasis	IEA	biological process
GO:0034097	response to cytokine	IEA	biological process
GO:0031339	negative regulation of vesicle fusion	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0008360	regulation of cell shape	IEA	biological process
GO:0008092	cytoskeletal protein binding	IEA	molecular function
GO:0008064	regulation of actin polymerization or depolymerization	IEA	biological process
GO:0007015	actin filament organization	IEA	biological process
GO:0006816	calcium ion transport	IEA	biological process
GO:0005911	cell-cell junction	IEA	cellular component
GO:0001772	immunological synapse	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0051015	actin filament binding	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0030864	cortical actin cytoskeleton	IDA	colocalizes with
GO:0030864	cortical actin cytoskeleton	IDA	cellular component
GO:0005634	nucleus	IDA	NOT|cellular component
GO:0001772	immunological synapse	IDA	cellular component
GO:0051015	actin filament binding	IDA	molecular function
GO:0043548	phosphatidylinositol 3-kinase binding	IDA	molecular function
GO:0001891	phagocytic cup	IDA	cellular component
GO:0051126	negative regulation of actin nucleation	IDA	biological process
GO:0050918	positive chemotaxis	IDA	biological process
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005884	actin filament	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0051015	actin filament binding	IMP	molecular function
GO:0003779	actin binding	IPI	molecular function
GO:0003785	actin monomer binding	IMP	molecular function
GO:0032036	myosin heavy chain binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051015	actin filament binding	IMP	molecular function
GO:0045087	innate immune response	NAS	biological process
GO:0031589	cell-substrate adhesion	IMP	biological process
GO:0001845	phagolysosome assembly	IMP	biological process
GO:0032956	regulation of actin cytoskeleton organization	IMP	biological process
GO:0001771	immunological synapse formation	IMP	NOT|biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0030036	actin cytoskeleton organization	IMP	biological process
GO:0008092	cytoskeletal protein binding	ISS	molecular function
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0006909	phagocytosis	IMP	biological process
GO:0043320	natural killer cell degranulation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05152	Tuberculosis
hsa04145	Phagosome

Diseases

Associated diseases	References
T-B+Severe combined immunodeficiency	KEGG:H00091
T-B+Severe combined immunodeficiency	KEGG:H00091
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray