• Gene id: 11145

Gene Summary

• Gene Symbol: PLAAT3   Gene   UCSC   Ensembl
• Aliases: AdPLA, H-REV107, H-REV107-1, HRASLS3, HREV107, HREV107-1, HREV107-3, HRSL3, PLA2G16, PLAAT-3
• Gene name: phospholipase A and acyltransferase 3
• Alternate names: phospholipase A and acyltransferase 3, Ca-independent phospholipase A1/2, H-rev 107 protein homolog, HRAS-like suppressor 1, HRAS-like suppressor 3, adipose-specific PLA2, adipose-specific phospholipase A2, group XVI phospholipase A1/A2, group XVI phospholipase A,
• Gene location: 11q12.3-q13.1 (63616925: 63574461)     Exons: 5     NC_000011.10
• OMIM: 613867

Protein Summary

• Protein general information: P53816  
  • Name: Phospholipase A and acyltransferase 3 (EC 2.3.1. ) (EC 3.1.1.32) (EC 3.1.1.4) (Adipose specific phospholipase A2) (AdPLA) (Group XVI phospholipase A1/A2) (H rev 107 protein homolog) (H REV107) (HREV107 1) (HRAS like suppressor 1) (HRAS like suppressor 3)
  • Length: 162  
  • Mass: 17937
  • Tissue specificity: Widely expressed. low expression, if any, in hematopoietic cells and thymus. In testis, confined to round spermatids. Expressed in normal ovarian epithelial cells. Down-regulated in some ovarian carcinomas and testicular germ cell tumo
• Sequence:

  MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQ
  VNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLI
  GVMFSRNKRQKQ

• Structural information:
  • Interpro: IPR007053  
  • PDB: 2KYT 4DOT 4FA0 4Q95
  • PDBsum: 2KYT 4DOT 4FA0 4Q95
  • STRING: ENSP00000320337
• Other Databases: GeneCards:  PLAAT3  Malacards:  PLAAT3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008970	phospholipase A1 activity	IBA	molecular function
GO:0070292	N-acylphosphatidylethanolamine metabolic process	IBA	biological process
GO:0016410	N-acyltransferase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0004623	phospholipase A2 activity	IBA	molecular function
GO:0008970	phospholipase A1 activity	IDA	molecular function
GO:0008970	phospholipase A1 activity	IDA	molecular function
GO:0004623	phospholipase A2 activity	IDA	molecular function
GO:0070292	N-acylphosphatidylethanolamine metabolic process	IDA	biological process
GO:0004623	phospholipase A2 activity	IDA	molecular function
GO:0016410	N-acyltransferase activity	IDA	molecular function
GO:0007031	peroxisome organization	ISS	biological process
GO:0005777	peroxisome	ISS	cellular component
GO:1904177	regulation of adipose tissue development	ISS	biological process
GO:0046485	ether lipid metabolic process	ISS	biological process
GO:0016042	lipid catabolic process	ISS	biological process
GO:0006641	triglyceride metabolic process	ISS	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0052740	1-acyl-2-lysophosphatidylserine acylhydrolase activity	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0008970	phospholipase A1 activity	IEA	molecular function
GO:0102567	phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA	molecular function
GO:0052739	phosphatidylserine 1-acylhydrolase activity	IEA	molecular function
GO:0102568	phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA	molecular function
GO:0036149	phosphatidylinositol acyl-chain remodeling	TAS	biological process
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0036152	phosphatidylethanolamine acyl-chain remodeling	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008970	phospholipase A1 activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0007031	peroxisome organization	IEA	biological process
GO:0008970	phospholipase A1 activity	IEA	molecular function
GO:0009617	response to bacterium	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045786	negative regulation of cell cycle	IEA	biological process
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0006641	triglyceride metabolic process	IEA	biological process
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0016042	lipid catabolic process	IEA	biological process
GO:0046485	ether lipid metabolic process	IEA	biological process
GO:1904177	regulation of adipose tissue development	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004623	phospholipase A2 activity	IDA	molecular function
GO:0006644	phospholipid metabolic process	IDA	biological process
GO:0005575	cellular_component	ND	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04014	Ras signaling pathway
hsa00564	Glycerophospholipid metabolism
hsa00590	Arachidonic acid metabolism
hsa00565	Ether lipid metabolism
hsa04923	Regulation of lipolysis in adipocytes
hsa00591	Linoleic acid metabolism
hsa00592	alpha-Linolenic acid metabolism

Diseases

Associated diseases	References
seminoma	PMID:11526504
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq