• Gene id: 11144

Gene Summary

• Gene Symbol: DMC1   Gene   UCSC   Ensembl
• Aliases: DMC1H, LIM15, dJ199H16.1
• Gene name: DNA meiotic recombinase 1
• Alternate names: meiotic recombination protein DMC1/LIM15 homolog, DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination, disrupted meiotic cDNA1, yeast, homolog of,
• Gene location: 22q13.1 (38570285: 38509153)     Exons: 16     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the superfamily of recombinases (also called DNA strand-exchange proteins). Recombinases are important for repairing double-strand DNA breaks during mitosis and meiosis. This protein, which is evolutionarily conserved, is rep
• OMIM: 602721

Protein Summary

• Protein general information: Q14565  
  • Name: Meiotic recombination protein DMC1/LIM15 homolog
  • Length: 340  
  • Mass: 37681
• Sequence:

  MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKE
  AANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGG
  YPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSI
  MALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTR
  ISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE

• Structural information:
  • Interpro: IPR003593  IPR011940  IPR013632  IPR016467  IPR010995   IPR027417  IPR033925  IPR020588  IPR020587  
  • Prosite: PS50162 PS50163
  • CDD: cd01123
  • PDB: 1V5W 2ZJB 4HYY 6R3P
  • PDBsum: 1V5W 2ZJB 4HYY 6R3P
  • DIP: 24192
  • STRING: ENSP00000216024
• Other Databases: GeneCards:  DMC1  Malacards:  DMC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000150	recombinase activity	IBA	molecular function
GO:0000794	condensed nuclear chromosome	IBA	cellular component
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0006312	mitotic recombination	IBA	biological process
GO:0008094	DNA-dependent ATPase activity	IBA	molecular function
GO:0042148	strand invasion	IBA	biological process
GO:0070192	chromosome organization involved in meiotic cell cycle	IBA	biological process
GO:0000730	DNA recombinase assembly	IBA	biological process
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0007131	reciprocal meiotic recombination	IBA	biological process
GO:0010212	response to ionizing radiation	IBA	biological process
GO:0005694	chromosome	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000150	recombinase activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0008094	DNA-dependent ATPase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006259	DNA metabolic process	IEA	biological process
GO:0007131	reciprocal meiotic recombination	IEA	biological process
GO:0051321	meiotic cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0003677	DNA binding	TAS	molecular function
GO:0005524	ATP binding	TAS	molecular function
GO:0007131	reciprocal meiotic recombination	TAS	biological process
GO:0007292	female gamete generation	TAS	biological process
GO:0000794	condensed nuclear chromosome	TAS	cellular component
GO:0051321	meiotic cell cycle	TAS	biological process
GO:0007283	spermatogenesis	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007286	spermatid development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007276	gamete generation	IEA	biological process
GO:0007129	synapsis	IEA	biological process
GO:0001556	oocyte maturation	IEA	biological process
GO:0001541	ovarian follicle development	IEA	biological process
GO:0000794	condensed nuclear chromosome	IEA	cellular component
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0007141	male meiosis I	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Cryptorchidism	MIK: 28606200
Non-obstructive azoospermia	MIK: 29331980
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29331980	Non-obstructive azoospermia	c.106G>A, p.Asp36Asn	Chinese	2	Male infertility	NGS
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq