• Gene id: 11142

Gene Summary

• Gene Symbol: PKIG   Gene   UCSC   Ensembl
• Aliases: PKI-gamma
• Gene name: cAMP-dependent protein kinase inhibitor gamma
• Alternate names: cAMP-dependent protein kinase inhibitor gamma, protein kinase (cAMP-dependent, catalytic) inhibitor gamma,
• Gene location: 20q13.12 (44531780: 44619036)     Exons: 9     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the protein kinase inhibitor family. Studies of a similar protein in mice suggest that this protein acts as a potent competitive cAMP-dependent protein kinase inhibitor, and is a predominant form of inhibitor in various tissu
• OMIM: 604932

Protein Summary

• Protein general information: Q9Y2B9  
  • Name: cAMP dependent protein kinase inhibitor gamma (PKI gamma)
  • Length: 76  
  • Mass: 7910
  • Tissue specificity: Ubiquitous.
• Sequence:

  MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTS
  S

• Structural information:
  • Interpro: IPR004171  
  • STRING: ENSP00000361980
• Other Databases: GeneCards:  PKIG  Malacards:  PKIG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2000480	negative regulation of cAMP-dependent protein kinase activity	IBA	biological process
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IEA	molecular function
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0004860	protein kinase inhibitor activity	IEA	molecular function
GO:0004862	cAMP-dependent protein kinase inhibitor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0042308	negative regulation of protein import into nucleus	IEA	biological process
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IEA	molecular function
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0004862	cAMP-dependent protein kinase inhibitor activity	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray