• Gene id: 1114

Gene Summary

• Gene Symbol: CHGB   Gene   UCSC   Ensembl
• Aliases: SCG1
• Gene name: chromogranin B
• Alternate names: secretogranin-1, cgB, secretogranin B, secretogranin I, sgI,
• Gene location: 20p12.3 (5911509: 5925352)     Exons: 5     NC_000020.11
• Gene summary(Entrez): This gene encodes a tyrosine-sulfated secretory protein abundant in peptidergic endocrine cells and neurons. This protein may serve as a precursor for regulatory peptides. [provided by RefSeq, Jan 2009]
• OMIM: 608500

Protein Summary

• Protein general information: P05060  
  • Name: Secretogranin 1 (Chromogranin B) (CgB) (Secretogranin I) (SgI) [Cleaved into: PE 11; GAWK peptide; CCB peptide]
  • Length: 677  
  • Mass: 78276
  • Tissue specificity: Expressed in the adrenal medulla, and in pheochromocytoma. Not expressed in liver. {ECO
• Sequence:

  MQPTLLLSLLGAVGLAAVNSMPVDNRNHNEGMVTRCIIEVLSNALSKSSAPPITPECRQVLKTSRKDVKDKETTE
  NENTKFEVRLLRDPADASEAHESSSRGEAGAPGEEDIQGPTKADTEKWAEGGGHSRERADEPQWSLYPSDSQVSE
  EVKTRHSEKSQREDEEEEEGENYQKGERGEDSSEEKHLEEPGETQNAFLNERKQASAIKKEELVARSETHAAGHS
  QEKTHSREKSSQESGEETGSQENHPQESKGQPRSQEESEEGEEDATSEVDKRRTRPRHHHGRSRPDRSSQGGSLP
  SEEKGHPQEESEESNVSMASLGEKRDHHSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRP
  QSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQE
  NQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPY
  YDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQ
  YDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQ
  RG

• Structural information:
  • Interpro: IPR001819  IPR018054  IPR001990  
  • Prosite: PS00422 PS00423
  • STRING: ENSP00000368244
• Other Databases: GeneCards:  CHGB  Malacards:  CHGB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030141	secretory granule	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0030141	secretory granule	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	TAS	molecular function
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030141	secretory granule	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray