• Gene id: 11132

Gene Summary

• Gene Symbol: CAPN10   Gene   UCSC   Ensembl
• Aliases: CANP10, NIDDM1
• Gene name: calpain 10
• Alternate names: calpain-10, calcium-activated neutral proteinase 10, calpain-like protease CAPN10,
• Gene location: 2q37.3 (240586733: 240599103)     Exons: 12     NC_000002.12
• Gene summary(Entrez): Calpains represent a ubiquitous, well-conserved family of calcium-dependent cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large catalytic subunit has four domains: domai
• OMIM: 600608

Protein Summary

• Protein general information: Q9HC96  
  • Name: Calpain 10 (EC 3.4.22. ) (Calcium activated neutral proteinase 10) (CANP 10)
  • Length: 672  
  • Mass: 74952
  • Tissue specificity: Detected in primary skeletal muscle cells (at protein level). Ubiquitous. {ECO
• Sequence:

  MRAGRGATPARELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEICATPRLFPDDPREGQVKQGLLGDCWF
  LCACAALQKSRHLLDQVIPPGQPSWADQEYRGSFTCRIWQFGRWVEVTTDDRLPCLAGRLCFSRCQREDVFWLPL
  LEKVYAKVHGSYEHLWAGQVADALVDLTGGLAERWNLKGVAGSGGQQDRPGRWEHRTCRQLLHLKDQCLISCCVL
  SPRAGARELGEFHAFIVSDLRELQGQAGQCILLLRIQNPWGRRCWQGLWREGGEGWSQVDAAVASELLSQLQEGE
  FWVEEEEFLREFDELTVGYPVTEAGHLQSLYTERLLCHTRALPGAWVKGQSAGGCRNNSGFPSNPKFWLRVSEPS
  EVYIAVLQRSRLHAADWAGRARALVGDSHTSWSPASIPGKHYQAVGLHLWKVEKRRVNLPRVLSMPPVAGTACHA
  YDREVHLRCELSPGYYLAVPSTFLKDAPGEFLLRVFSTGRVSLSAIRAVAKNTTPGAALPAGEWGTVQLRGSWRV
  GQTAGGSRNFASYPTNPCFPFSVPEGPGPRCVRITLHQHCRPSDTEFHPIGFHIFQVPEGGRSQDAPPLLLQEPL
  LSCVPHRYAQEVSRLCLLPAGTYKVVPSTYLPDTEGAFTVTIATRIDRPSIHSQEMLGQFLQEVSIMAVMKT

• Structural information:
  • Protein Domains: (13..32-)
    (/note="Calpain-catalytic)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00239"-)
  • Interpro: IPR033883  IPR022684  IPR022682  IPR022683  IPR036213   IPR028791  IPR038765  IPR000169  IPR001300  
  • Prosite: PS50203 PS00139
  • CDD: cd00214 cd00044
  • STRING: ENSP00000375844
• Other Databases: GeneCards:  CAPN10  Malacards:  CAPN10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IBA	biological process
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:2000676	positive regulation of type B pancreatic cell apoptotic process	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0032388	positive regulation of intracellular transport	IEA	biological process
GO:0097050	type B pancreatic cell apoptotic process	IEA	biological process
GO:0046326	positive regulation of glucose import	IEA	biological process
GO:0031532	actin cytoskeleton reorganization	IEA	biological process
GO:0008092	cytoskeletal protein binding	ISS	molecular function
GO:0000149	SNARE binding	ISS	molecular function
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	IMP	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0006921	cellular component disassembly involved in execution phase of apoptosis	IC	biological process
GO:0005739	mitochondrion	IDA	cellular component
GO:0097050	type B pancreatic cell apoptotic process	IDA	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0006508	proteolysis	IMP	biological process
GO:0032388	positive regulation of intracellular transport	ISS	biological process
GO:0032869	cellular response to insulin stimulus	IMP	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0031532	actin cytoskeleton reorganization	ISS	biological process
GO:0032024	positive regulation of insulin secretion	IMP	biological process
GO:0046326	positive regulation of glucose import	IMP	biological process

Diseases

Associated diseases	References
Type 2 diabetes mellitus	KEGG:H00409
Type 2 diabetes mellitus	KEGG:H00409
Polycystic ovary syndrome	PMID:17106059
pancreatic cancer	PMID:20178008
type 2 diabetes mellitus	PMID:19688040
type 2 diabetes mellitus	PMID:16721485
type 2 diabetes mellitus	PMID:20406624
type 2 diabetes mellitus	PMID:18554168
obesity	PMID:16752174
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq