• Gene id: 11130

Gene Summary

• Gene Symbol: ZWINT   Gene   UCSC   Ensembl
• Aliases: HZwint-1, KNTC2AP, SIP30, ZWINT1
• Gene name: ZW10 interacting kinetochore protein
• Alternate names: ZW10 interactor, SNAP25 interacting protein of 30 kDa, ZW10 interactor, kinetochore protein, human ZW10 interacting protein-1, zwint-1,
• Gene location: 10q21.1 (56361272: 56357226)     Exons: 9     NC_000010.11
• Gene summary(Entrez): This gene encodes a protein that is clearly involved in kinetochore function although an exact role is not known. It interacts with ZW10, another kinetochore protein, possibly regulating the association between ZW10 and kinetochores. The encoded protein l
• OMIM: 609177

Protein Summary

• Protein general information: O95229  
  • Name: ZW10 interactor (ZW10 interacting protein 1) (Zwint 1)
  • Length: 277  
  • Mass: 31293
• Sequence:

  MEAAETEAEAAALEVLAEVAGILEPVGLQEEAELPAKILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKG
  LDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRR
  AVQNQWQLQQEKHLQHLAEVSAEVRERKTGTQQELDRVFQKLGNLKQQAEQERDKLQRYQTFLQLLYTLQGKLLF
  PEAEAEAENLPDDKPQQPTRPQEQSTGDTMGRDPGVSFKAVGLQPAGDVNLP

• Structural information:
  • Interpro: IPR029092  
  • STRING: ENSP00000363055
• Other Databases: GeneCards:  ZWINT  Malacards:  ZWINT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007093	mitotic cell cycle checkpoint	IDA	biological process
GO:0000776	kinetochore	IDA	cellular component
GO:0051649	establishment of localization in cell	IDA	biological process
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0000070	mitotic sister chromatid segregation	IDA	biological process
GO:0051649	establishment of localization in cell	IBA	biological process
GO:0030425	dendrite	IBA	cellular component
GO:0007093	mitotic cell cycle checkpoint	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0000776	kinetochore	IBA	cellular component
GO:0016604	nuclear body	IBA	cellular component
GO:0000070	mitotic sister chromatid segregation	IBA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0007093	mitotic cell cycle checkpoint	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0051301	cell division	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0000776	kinetochore	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray