• Gene id: 11127

Gene Summary

• Gene Symbol: KIF3A   Gene   UCSC   Ensembl
• Aliases: FLA10, KLP-20
• Gene name: kinesin family member 3A
• Alternate names: kinesin-like protein KIF3A, kinesin family protein 3A, microtubule plus end-directed kinesin motor 3A,
• Gene location: 5q31.1 (132737577: 132688807)     Exons: 20     NC_000005.10
• OMIM: 604683

Protein Summary

• Protein general information: Q9Y496  
  • Name: Kinesin like protein KIF3A (Microtubule plus end directed kinesin motor 3A)
  • Length: 699  
  • Mass: 80,041
• Sequence:

  MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSSNEPPKTFTFDTVFGPESKQLD
  VYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYL
  EIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGATNMNEHSSRSHAIFT
  ITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNS
  KLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKARINEDPKDALLRQFQKEIEELKKKLE
  EGEEISGSDISGSEEDDDEEGEVGEDGEKRKKRRGKKKVSPDKMIEMQAKIDEERKALETKLDMEEEERNKARAE
  LEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQER
  LDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDY
  QEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKG
  KARPKTGRRKRSAKPETVIDSLLQ

• Structural information:
  • Protein Domains: Kinesin (14-345)
  • Interpro: IPR027640  IPR019821  IPR001752  IPR036961  IPR027417  
  • Prosite: PS00411 PS50067
  • DIP: 33237
  • STRING: ENSP00000368020
• Other Databases: GeneCards:  KIF3A  Malacards:  KIF3A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to ER	TAS	biological process
GO:0006996	organelle organization	TAS	biological process
GO:0007018	microtubule-based movement	TAS	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	TAS	molecular function
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016939	kinesin II complex	IDA	cellular component
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0022008	neurogenesis	IBA	biological process
GO:0030507	spectrin binding	IDA	molecular function
GO:0060271	cilium assembly	IBA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072383	plus-end-directed vesicle transport along microtubule	TAS	biological process
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0005876	spindle microtubule	IDA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to ER	TAS	biological process
GO:0006996	organelle organization	TAS	biological process
GO:0007018	microtubule-based movement	IEA	biological process
GO:0007018	microtubule-based movement	TAS	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	TAS	molecular function
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016939	kinesin II complex	IDA	cellular component
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0022008	neurogenesis	IBA	biological process
GO:0030030	cell projection organization	IEA	biological process
GO:0030507	spectrin binding	IDA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0060271	cilium assembly	IBA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072383	plus-end-directed vesicle transport along microtubule	TAS	biological process
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0005876	spindle microtubule	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to ER	TAS	biological process
GO:0006996	organelle organization	TAS	biological process
GO:0007018	microtubule-based movement	TAS	biological process
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	TAS	molecular function
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016939	kinesin II complex	IDA	cellular component
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0022008	neurogenesis	IBA	biological process
GO:0030507	spectrin binding	IDA	molecular function
GO:0060271	cilium assembly	IBA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072383	plus-end-directed vesicle transport along microtubule	TAS	biological process
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0005876	spindle microtubule	IDA	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 21898990
Asthenozoospermia	MIK: 21898990
Dermatitis	GAD: 22197932
Associated with spermatoid elongation	MIK: 26245936
Asthenospermia	MIK: 21898990
Sperm tail formation and manchette function	MIK: 23831641
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21898990	Asthenospermia				Male infertility	KIF3B MYO15A KIF6 KIF26B KIF3A DNHD2 DMN DYNC2H1 STARD9 MYOHD1 and TPM1
26245936	Associated with spermatoid elongation				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
23831641	Sperm tail formation and manchette function				Male infertility