• Gene id: 11126

Gene Summary

• Gene Symbol: CD160   Gene   UCSC   Ensembl
• Aliases: BY55, NK1, NK28
• Gene name: CD160 molecule
• Alternate names: CD160 antigen, CD160 transmembrane isoform, CD160-delta Ig, natural killer cell receptor BY55, natural killer cell receptor, immunoglobulin superfamily member,
• Gene location: 1q21.1 (145719311: 145739287)     Exons: 6     NC_000001.11
• Gene summary(Entrez): CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predic
• OMIM: 612128

Protein Summary

• Protein general information: O95971  
  • Name: CD160 antigen (Natural killer cell receptor BY55) (CD antigen CD160) [Cleaved into: CD160 antigen, soluble form]
  • Length: 181  
  • Mass: 19810
  • Tissue specificity: Expression is restricted to functional NK and cytotoxic T lymphocytes. Expressed in viral-specific effector memory and terminally differentiated effector memory CD8+ T cells. Expressed in memory and activated CD4+ T cell subsets (at pr
• Sequence:

  MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLK
  QLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLE
  FSHNEGTLSSGFLQEKVWVMLVTSLVALQAL

• Structural information:
  • Protein Domains: (25..13-)
    (/note="Ig-like-V-type)
    (/evidence="ECO:0000305|PubMed:19109136"-)
  • Interpro: IPR042385  IPR036179  IPR013783  
  • PDB: 6NG3 6NG9 6NGG
  • PDBsum: 6NG3 6NG9 6NGG
  • STRING: ENSP00000235933
• Other Databases: GeneCards:  CD160  Malacards:  CD160

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	signaling receptor binding	IDA	molecular function
GO:0032393	MHC class I receptor activity	IDA	molecular function
GO:0046658	anchored component of plasma membrane	IDA	cellular component
GO:0046658	anchored component of plasma membrane	IBA	cellular component
GO:0002729	positive regulation of natural killer cell cytokine production	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0014065	phosphatidylinositol 3-kinase signaling	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0032397	activating MHC class I receptor activity	IDA	molecular function
GO:0031295	T cell costimulation	IDA	biological process
GO:0032397	activating MHC class I receptor activity	IDA	molecular function
GO:1905675	negative regulation of adaptive immune memory response	IDA	biological process
GO:0031295	T cell costimulation	IDA	biological process
GO:0032397	activating MHC class I receptor activity	IDA	molecular function
GO:1900280	negative regulation of CD4-positive, alpha-beta T cell costimulation	IDA	biological process
GO:2000353	positive regulation of endothelial cell apoptotic process	IDA	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IDA	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0032394	MHC class Ib receptor activity	IDA	molecular function
GO:0050860	negative regulation of T cell receptor signaling pathway	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019900	kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002819	regulation of adaptive immune response	IEA	biological process
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002385	mucosal immune response	IEA	biological process
GO:1902715	positive regulation of interferon-gamma secretion	IEA	biological process
GO:0050829	defense response to Gram-negative bacterium	IEA	biological process
GO:0023024	MHC class I protein complex binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0002857	positive regulation of natural killer cell mediated immune response to tumor cell	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray