• Gene id: 11123

Gene Summary

• Gene Symbol: RCAN3   Gene   UCSC   Ensembl
• Aliases: DSCR1L2, MCIP3, RCN3, hRCN3
• Gene name: RCAN family member 3
• Alternate names: calcipressin-3, Down syndrome candidate region 1-like 2, Down syndrome critical region gene 1-like 2, down syndrome candidate region 1-like protein 2, myocyte-enriched calcineurin-interacting protein 3, regulator of calcineurin 3 isoform 1b,2,
• Gene location: 1p36.11 (24502343: 24541039)     Exons: 7     NC_000001.11
• OMIM: 605860

Protein Summary

• Protein general information: Q9UKA8  
  • Name: Calcipressin 3 (Down syndrome candidate region 1 like protein 2) (Myocyte enriched calcineurin interacting protein 3) (MCIP3) (Regulator of calcineurin 3)
  • Length: 241  
  • Mass: 27492
  • Tissue specificity: Highest expression in heart, skeletal muscle kidney, liver and peripheral blood leukocytes. Lower expression in all other tissues.
• Sequence:

  MLRDTMKSWNDSQSDLCSTDQEEEEEMIFGENEDDLDEMMDLSDLPTSLFACSVHEAVFEAREQKERFEALFTIY
  DDQVTFQLFKSFRRVRINFSKPEAAARARIELHETDFNGQKLKLYFAQVQMSGEVRDKSYLLPPQPVKQFLISPP
  ASPPVGWKQSEDAMPVINYDLLCAVSKLGPGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPD
  PPTAALNEPQTFDCAL

• Structural information:
  • Interpro: IPR006931  IPR012677  IPR035979  IPR034923  
  • STRING: ENSP00000363516
• Other Databases: GeneCards:  RCAN3  Malacards:  RCAN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070884	regulation of calcineurin-NFAT signaling cascade	IBA	biological process
GO:0008597	calcium-dependent protein serine/threonine phosphatase regulator activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0019722	calcium-mediated signaling	IEA	biological process
GO:0003723	RNA binding	TAS	molecular function
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043666	regulation of phosphoprotein phosphatase activity	IEA	biological process
GO:0031013	troponin I binding	IPI	molecular function
GO:0019902	phosphatase binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R