• Gene id: 11122

Gene Summary

• Gene Symbol: PTPRT   Gene   UCSC   Ensembl
• Aliases: RPTPrho
• Gene name: protein tyrosine phosphatase receptor type T
• Alternate names: receptor-type tyrosine-protein phosphatase T, R-PTP-T, RPTP-rho, receptor protein tyrosine phosphatase, receptor-type tyrosine-protein phosphatase rho,
• Gene location: 20q12-q13.11 (43189905: 42029958)     Exons: 37     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic tran
• OMIM: 608712

Protein Summary

• Protein general information: O14522  
  • Name: Receptor type tyrosine protein phosphatase T (R PTP T) (EC 3.1.3.48) (Receptor type tyrosine protein phosphatase rho) (RPTP rho)
  • Length: 1441  
  • Mass: 162134
  • Tissue specificity: Expressed in colon, lung, heart and testis, as well as in fetal and adult brain. Not detected in muscle and peripheral blood leukocytes. {ECO
• Sequence:

  MASLAALALSLLLRLQLPPLPGARAQSAAGGCSFDEHYSNCGYSVALGTNGFTWEQINTWEKPMLDQAVPTGSFM
  MVNSSGRASGQKAHLLLPTLKENDTHCIDFHYYFSSRDRSSPGALNVYVKVNGGPQGNPVWNVSGVVTEGWVKAE
  LAISTFWPHFYQVIFESVSLKGHPGYIAVDEVRVLAHPCRKAPHFLRLQNVEVNVGQNATFQCIAGGKWSQHDKL
  WLQQWNGRDTALMVTRVVNHRRFSATVSVADTAQRSVSKYRCVIRSDGGSGVSNYAELIVKEPPTPIAPPELLAV
  GATYLWIKPNANSIIGDGPIILKEVEYRTTTGTWAETHIVDSPNYKLWHLDPDVEYEIRVLLTRPGEGGTGPPGP
  PLTTRTKCADPVHGPQNVEIVDIRARQLTLQWEPFGYAVTRCHSYNLTVQYQYVFNQQQYEAEEVIQTSSHYTLR
  GLRPFMTIRLRLLLSNPEGRMESEELVVQTEEDVPGAVPLESIQGGPFEEKIYIQWKPPNETNGVITLYEINYKA
  VGSLDPSADLSSQRGKVFKLRNETHHLFVGLYPGTTYSFTIKASTAKGFGPPVTTRIATKISAPSMPEYDTDTPL
  NETDTTITVMLKPAQSRGAPVSVYQLVVKEERLQKSRRAADIIECFSVPVSYRNASSLDSLHYFAAELKPANLPV
  TQPFTVGDNKTYNGYWNPPLSPLKSYSIYFQALSKANGETKINCVRLATKGASTQNSNTVEPEKQVDNTVKMAGV
  IAGLLMFIIILLGVMLTIKRRRNAYSYSYYLKLAKKQKETQSGAQREMGPVASADKPTTKLSASRNDEGFSSSSQ
  DVNGFTDGSRGELSQPTLTIQTHPYRTCDPVEMSYPRDQFQPAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQ
  TASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYIDGYHRPRHYIATQGPMQETVKDFWRMI
  WQENSASIVMVTNLVEVGRVKCVRYWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSW
  PDHGVPCYATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELRAQRVN
  LVQTEEQYVFVHDAILEACLCGNTAIPVCEFRSLYYNISRLDPQTNSSQIKDEFQTLNIVTPRVRPEDCSIGLLP
  RNHDKNRSMDVLPLDRCLPFLISVDGESSNYINAALMDSHKQPAAFVVTQHPLPNTVADFWRLVFDYNCSSVVML
  NEMDTAQFCMQYWPEKTSGCYGPIQVEFVSADIDEDIIHRIFRICNMARPQDGYRIVQHLQYIGWPAYRDTPPSK
  RSLLKVVRRLEKWQEQYDGREGRTVVHCLNGGGRSGTFCAICSVCEMIQQQNIIDVFHIVKTLRNNKSNMVETLE
  QYKFVYEVALEYLSSF

• Structural information:
  • Protein Domains: (30..19-)
    (/note="MAM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00128-)
    (193..28-)
    (/note="Ig-like-C2-type)
    (291..38-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (389..48-)
    (/note="Fibro-)
  • Interpro: IPR013320  IPR003961  IPR036116  IPR007110  IPR036179   IPR013783  IPR000998  IPR029021  IPR000242  IPR016130  IPR003595  IPR000387  
  • Prosite: PS50853 PS50835 PS00740 PS50060 PS00383 PS50056 PS50055
  • CDD: cd00063 cd06263
  • PDB: 2OOQ
  • PDBsum: 2OOQ
  • DIP: 33967
  • STRING: ENSP00000362294
• Other Databases: GeneCards:  PTPRT  Malacards:  PTPRT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904893	negative regulation of receptor signaling pathway via STAT	IDA	biological process
GO:1990264	peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005001	transmembrane receptor protein tyrosine phosphatase activity	IDA	molecular function
GO:0097677	STAT family protein binding	IPI	molecular function
GO:0004725	protein tyrosine phosphatase activity	IMP	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0071354	cellular response to interleukin-6	IDA	biological process
GO:1904893	negative regulation of receptor signaling pathway via STAT	IMP	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0045294	alpha-catenin binding	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0045295	gamma-catenin binding	IDA	molecular function
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IMP	biological process
GO:0045296	cadherin binding	IPI	molecular function
GO:0045296	cadherin binding	IPI	molecular function
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0007165	signal transduction	NAS	biological process
GO:0070097	delta-catenin binding	IPI	molecular function
GO:0007155	cell adhesion	NAS	biological process
GO:0045296	cadherin binding	IPI	molecular function
GO:0004725	protein tyrosine phosphatase activity	IMP	molecular function
GO:0004725	protein tyrosine phosphatase activity	IMP	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq