• Gene id: 11105

Gene Summary

• Gene Symbol: PRDM7   Gene   UCSC   Ensembl
• Aliases: PFM4, ZNF910
• Gene name: PR/SET domain 7
• Alternate names: probable histone-lysine N-methyltransferase PRDM7, PR domain 7, PR domain containing 7, PR domain zinc finger protein 7, PR-domain family protein 4,
• Gene location: 16q24.3 (90077338: 90056565)     Exons: 11     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of a family of proteins that may have roles in transcription and other nuclear processes. The encoded protein contains a KRAB (Kruppel-associated box) domain -A box and a SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain and
• OMIM: 609857

Protein Summary

• Protein general information: Q9NQW5  
  • Name: Probable histone lysine N methyltransferase PRDM7 (EC 2.1.1. ) (PR domain zinc finger protein 7) (PR domain containing protein 7)
  • Length: 492  
  • Mass: 55777
• Sequence:

  MSPERSQEESPEGDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKMNYNALITVGLRATRPAFMC
  HRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMAFRGEQSKHQKGMPKASFNNESSLRELSGTPNLLNTSDSEQAQK
  PVSPPGEASTSGQHSRLKLELRRKETEGKMYSLRERKGHAYKEISEPQDDDYLYCEMCQNFFIDSCAAHGPPTFV
  KDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRITEDEEAANSGYSWLITKGRN
  CYEYVDGKDKSSANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWSGDEYGQELGIRSSIEPAE
  SLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHVPHAVWPFQVKNFSVNMWNAITPLRTSQDHL
  QENFSNQRIPAQGIRIRSGNILIHAAVMTKPKVKRSKKGPNS

• Structural information:
  • Protein Domains: (23..8-)
    (/note="KRAB-related-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00120-)
    (244..35-)
    (/note="SET-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00190"-)
  • Interpro: IPR001909  IPR036051  IPR003655  IPR001214  IPR019041  
  • Prosite: PS50806 PS50280
  • CDD: cd07765
  • STRING: ENSP00000396732
• Other Databases: GeneCards:  PRDM7  Malacards:  PRDM7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042800	histone methyltransferase activity (H3-K4 specific)	IDA	molecular function
GO:0080182	histone H3-K4 trimethylation	IDA	biological process
GO:0046975	histone methyltransferase activity (H3-K36 specific)	IBA	molecular function
GO:0042800	histone methyltransferase activity (H3-K4 specific)	IBA	molecular function
GO:0010845	positive regulation of reciprocal meiotic recombination	IBA	biological process
GO:0042054	histone methyltransferase activity	IBA	molecular function
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0010452	histone H3-K36 methylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00310	Lysine degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881