• Gene id: 11104

Gene Summary

• Gene Symbol: KATNA1   Gene   UCSC   Ensembl
• Gene name: katanin catalytic subunit A1
• Alternate names: katanin p60 ATPase-containing subunit A1, katanin p60 (ATPase containing) subunit A 1, katanin p60 subunit A1, p60 katanin,
• Gene location: 6q25.1 (149649017: 149594872)     Exons: 14     NC_000006.12
• Gene summary(Entrez): Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa
• OMIM: 606696

Protein Summary

• Protein general information: O75449  
  • Name: Katanin p60 ATPase containing subunit A1 (Katanin p60 subunit A1) (EC 5.6.1.1) (p60 katanin)
  • Length: 491  
  • Mass: 55965
• Sequence:

  MSLLMISENVKLAREYALLGNYDSAMVYYQGVLDQMNKYLYSVKDTYLQQKWQQVWQEINVEAKHVKDIMKTLES
  FKLDSTPLKAAQHDLPASEGEVWSMPVPVERRPSPGPRKRQSSQYSDPKSHGNRPSTTVRVHRSSAQNVHNDRGK
  AVRCREKKEQNKGREEKNKSPAAVTEPETNKFDSTGYDKDLVEALERDIISQNPNVRWDDIADLVEAKKLLKEAV
  VLPMWMPEFFKGIRRPWKGVLMVGPPGTGKTLLAKAVATECKTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFY
  SPATIFIDEIDSICSRRGTSEEHEASRRVKAELLVQMDGVGGTSENDDPSKMVMVLAATNFPWDIDEALRRRLEK
  RIYIPLPSAKGREELLRISLRELELADDVDLASIAENMEGYSGADITNVCRDASLMAMRRRIEGLTPEEIRNLSK
  EEMHMPTTMEDFEMALKKVSKSVSAADIERYEKWIFEFGSC

• Structural information:
  • Interpro: IPR003593  IPR041569  IPR003959  IPR003960  IPR028596   IPR027417  
  • Prosite: PS00674
  • PDB: 5ZQL 5ZQM
  • PDBsum: 5ZQL 5ZQM
  • STRING: ENSP00000356381
• Other Databases: GeneCards:  KATNA1  Malacards:  KATNA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031122	cytoplasmic microtubule organization	IBA	biological process
GO:0008568	microtubule-severing ATPase activity	IBA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0005819	spindle	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0000922	spindle pole	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0008568	microtubule-severing ATPase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0051013	microtubule severing	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016853	isomerase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0008568	microtubule-severing ATPase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0005813	centrosome	IEA	cellular component
GO:0051013	microtubule severing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0008568	microtubule-severing ATPase activity	IDA	molecular function
GO:0008017	microtubule binding	IDA	molecular function
GO:0000922	spindle pole	IDA	cellular component
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R