• Gene id: 11102

Gene Summary

• Gene Symbol: RPP14   Gene   UCSC   Ensembl
• Aliases: P14
• Gene name: ribonuclease P/MRP subunit p14
• Alternate names: ribonuclease P protein subunit p14, ribonuclease P/MRP 14kDa subunit,
• Gene location: 3p14.3 (27147773: 27145395)     Exons: 2     NC_000007.14
• Gene summary(Entrez): This gene encodes a subunit of ribonuclease P and has 3' to 5' exoribonuclease activity. Transcripts for this gene are bicistronic and include a conserved downstream open reading frame for the hydroxyacyl-thioester dehydratase type 2 (HTD2) gene. [provide
• OMIM: 606112

Protein Summary

• Protein general information: O95059  
  • Name: Ribonuclease P protein subunit p14 (EC 3.1.26.5)
  • Length: 124  
  • Mass: 13693
• Sequence:

  MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAIL
  RICSSGLVKLWSSLTLLGSYKGKKCAFRVIQVSPFLLALSGNSRELVLD

• Structural information:
  • Interpro: IPR002759  IPR038085  
  • PDB: 6AHR 6AHU
  • PDBsum: 6AHR 6AHU
  • STRING: ENSP00000412894
• Other Databases: GeneCards:  RPP14  Malacards:  RPP14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008033	tRNA processing	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0004526	ribonuclease P activity	IEA	molecular function
GO:0004526	ribonuclease P activity	IDA	contributes to
GO:0001682	tRNA 5'-leader removal	IDA	biological process
GO:0030681	multimeric ribonuclease P complex	IDA	cellular component
GO:0001682	tRNA 5'-leader removal	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0033204	ribonuclease P RNA binding	IDA	molecular function
GO:0030681	multimeric ribonuclease P complex	IDA	cellular component
GO:0001682	tRNA 5'-leader removal	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0004526	ribonuclease P activity	IDA	contributes to
GO:0008033	tRNA processing	IEA	biological process
GO:0004540	ribonuclease activity	IEA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)