• Gene id: 11101

Gene Summary

• Gene Symbol: ATE1   Gene   UCSC   Ensembl
• Gene name: arginyltransferase 1
• Alternate names: arginyl-tRNA--protein transferase 1, R-transferase 1, arginine-tRNA--protein transferase 1, arginyl-tRNA-protein transferase,
• Gene location: 10q26.13 (121928800: 121740420)     Exons: 16     NC_000010.11
• Gene summary(Entrez): This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin
• OMIM: 0

Protein Summary

• Protein general information: O95260  
  • Name: Arginyl tRNA protein transferase 1 (Arginyltransferase 1) (R transferase 1) (EC 2.3.2.8) (Arginine tRNA protein transferase 1)
  • Length: 518  
  • Mass: 59090
• Sequence:

  MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQY
  TIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTMDDAVAGDFALINKLDIQCDLKTLSDDIKES
  LESEGKNSKKEEPQELLQSQDFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNP
  AGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLEVRVVRSSPPSSQFKATLLESYQVYKRYQM
  VIHKNPPDTPTESQFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDILPNCVSSVYLYYDPDYS
  FLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKGQYRPSDLLCPETYVWVPIEQCLPSLENSKY
  CRFNQDPEAVDEDRSTEPDRLQVFHKRAIMPYGVYKKQQKDPSEEAAVLQYASLVGQKCSERMLLFRN

• Structural information:
  • Interpro: IPR016181  IPR017137  IPR030700  IPR007472  IPR007471  
  • STRING: ENSP00000224652
• Other Databases: GeneCards:  ATE1  Malacards:  ATE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016598	protein arginylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004057	arginyltransferase activity	IBA	molecular function
GO:0016598	protein arginylation	IEA	biological process
GO:0004057	arginyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004057	arginyltransferase activity	IEA	molecular function
GO:0010498	proteasomal protein catabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016598	protein arginylation	IEA	biological process
GO:0004057	arginyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0016598	protein arginylation	NAS	biological process
GO:0004057	arginyltransferase activity	TAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray