• Gene id: 11096

Gene Summary

• Gene Symbol: ADAMTS5   Gene   UCSC   Ensembl
• Aliases: ADAM-TS 11, ADAM-TS 5, ADAM-TS5, ADAMTS-11, ADAMTS-5, ADAMTS11, ADMP-2
• Gene name: ADAM metallopeptidase with thrombospondin type 1 motif 5
• Alternate names: A disintegrin and metalloproteinase with thrombospondin motifs 5, a disintegrin and metalloproteinase with thrombospondin motifs 11, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 5 (aggrecanase-2), aggrecanase-,
• Gene location: 21q21.3 (26967757: 26917911)     Exons: 9     NC_000021.9
• Gene summary(Entrez): This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegri
• OMIM: 605007

Protein Summary

• Protein general information: Q9UNA0  
  • Name: A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAM TS 5) (ADAM TS5) (ADAMTS 5) (EC 3.4.24. ) (A disintegrin and metalloproteinase with thrombospondin motifs 11) (ADAM TS 11) (ADAMTS 11) (ADMP 2) (Aggrecanase 2)
  • Length: 930  
  • Mass: 101,718
• Sequence:

  MLLGWASLLLCAFRLPLAAVGPAATPAQDKAGQPPTAAAAAQPRRRQGEEVQERAEPPGHPHPLAQRRRSKGLVQ
  NIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSPRSLAVFDLCG
  GLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGSARILHVYTREGFSFEALPPRASCETPASTPEAHEHAPAH
  SNPSGRAALASQLLDQSALSPAGGSGPQTWWRRRRRSISRARQVELLLVADASMARLYGRGLQHYLLTLASIANR
  LYSHASIENHIRLAVVKVVVLGDKDKSLEVSKNAATTLKNFCKWQHQHNQLGDDHEEHYDAAILFTREDLCGHHS
  CDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSHDDSKFCEETFGSTEDKRLMSSILTSIDASK
  PWSKCTSATITEFLDDGHGNCLLDLPRKQILGPEELPGQTYDATQQCNLTFGPEYSVCPGMDVCARLWCAVVRQG
  QMVCLTKKLPAVEGTPCGKGRICLQGKCVDKTKKKYYSTSSHGNWGSWGSWGQCSRSCGGGVQFAYRHCNNPAPR
  NNGRYCTGKRAIYRSCSLMPCPPNGKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVLPADVCKLTCRAKGTG
  YYVVFSPKVTDGTECRLYSNSVCVRGKCVRTGCDGIIGSKLQYDKCGVCGGDNSSCTKIVGTFNKKSKGYTDVVR
  IPEGATHIKVRQFKAKDQTRFTAYLALKKKNGEYLINGKYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSA
  TKEILIVQILATDPTKPLDVRYSFFVPKKSTPKVNSVTSHGSNKVGSHTSQPQWVTGPWLACSRTCDTGWHTRTV
  QCQDGNRKLAKGCPLSQRPSAFKQCLLKKC

• Structural information:
  • Protein Domains: Peptidase (267-476)
    Disintegrin (485-566)
    TSP (567-622)
    TSP (875-929)
  • Interpro: IPR006586  IPR010294  IPR024079  IPR013276  IPR001590   IPR002870  IPR000884  IPR036383  
  • Prosite: PS50215 PS50092 PS00142
  • PDB: 2RJQ 3B8Z 3HY7 3HY9 3HYG 3LJT
  • PDBsum: 2RJQ 3B8Z 3HY7 3HY9 3HYG 3LJT
  • STRING: ENSP00000284987
• Other Databases: GeneCards:  ADAMTS5  Malacards:  ADAMTS5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0005178	integrin binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0008237	metallopeptidase activity	TAS	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0036066	protein O-linked fucosylation	TAS	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0050840	extracellular matrix binding	IEA	molecular function
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0005178	integrin binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	IEA	cellular component
GO:0005578	proteinaceous extracellular matrix	TAS	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	TAS	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	TAS	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0036066	protein O-linked fucosylation	TAS	biological process
GO:0042742	defense response to bacterium	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0050840	extracellular matrix binding	IEA	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0004222	metalloendopeptidase activity	TAS	molecular function
GO:0005178	integrin binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005578	proteinaceous extracellular matrix	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0008237	metallopeptidase activity	TAS	molecular function
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0036066	protein O-linked fucosylation	TAS	biological process

Diseases

Associated diseases	References
Degenerative arthropathy	GAD: 20237151
Male factor infertility	MIK: 26888488
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 29737873
Male infertility	MIK: 26888488
Spermatogenic failure	MIK: 17921478
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26888488	Male infertility			70 (60 infertile (20 normozoospermia, 20 oligozoopsermia, 20 ADAMTS5), 10 healthy semen donors)	Male infertility	ADAMTS1 ADAMTS5
29737873	Azoospermia, Male infertility			15 (5 obstructive azoospermia, 10 non obstructive azoospermia)	Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray
17921478	Spermatogenic failure			69 samples	Male infertility	Microarray