• Gene id: 11095

Gene Summary

• Gene Symbol: ADAMTS8   Gene   UCSC   Ensembl
• Aliases: ADAM-TS8, METH2
• Gene name: ADAM metallopeptidase with thrombospondin type 1 motif 8
• Alternate names: A disintegrin and metalloproteinase with thrombospondin motifs 8, ADAMTS-8, METH-2, METH-8, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 8,
• Gene location: 11q24.3 (130428608: 130404922)     Exons: 9     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegri
• OMIM: 615620

Protein Summary

• Protein general information: Q9UP79  
  • Name: A disintegrin and metalloproteinase with thrombospondin motifs 8 (ADAM TS 8) (ADAM TS8) (ADAMTS 8) (EC 3.4.24. ) (METH 2) (METH 8)
  • Length: 889  
  • Mass: 96460
  • Tissue specificity: Highly expressed in adult and fetal lung, lower expression in brain, placenta, heart, stomach and fetal brain and kidney.
• Sequence:

  MLPAPAAPRWPPLLLLLLLLLPLARGAPARPAAGGQASELVVPTRLPGSAGELALHLSAFGKGFVLRLAPDDSFL
  APEFKIERLGGSGRATGGERGLRGCFFSGTVNGEPESLAAVSLCRGLSGSFLLDGEEFTIQPQGAGGSLAQPHRL
  QRWGPAGARPLPRGPEWEVETGEGQRQERGDHQEDSEEESQEEEAEGASEPPPPLGATSRTKRFVSEARFVETLL
  VADASMAAFYGADLQNHILTLMSVAARIYKHPSIKNSINLMVVKVLIVEDEKWGPEVSDNGGLTLRNFCNWQRRF
  NQPSDRHPEHYDTAILLTRQNFCGQEGLCDTLGVADIGTICDPNKSCSVIEDEGLQAAHTLAHELGHVLSMPHDD
  SKPCTRLFGPMGKHHVMAPLFVHLNQTLPWSPCSAMYLTELLDGGHGDCLLDAPAAALPLPTGLPGRMALYQLDQ
  QCRQIFGPDFRHCPNTSAQDVCAQLWCHTDGAEPLCHTKNGSLPWADGTPCGPGHLCSEGSCLPEEEVERPKPVA
  DGGWAPWGPWGECSRTCGGGVQFSHRECKDPEPQNGGRYCLGRRAKYQSCHTEECPPDGKSFREQQCEKYNAYNY
  TDMDGNLLQWVPKYAGVSPRDRCKLFCRARGRSEFKVFEAKVIDGTLCGPETLAICVRGQCVKAGCDHVVDSPRK
  LDKCGVCGGKGNSCRKVSGSLTPTNYGYNDIVTIPAGATNIDVKQRSHPGVQNDGNYLALKTADGQYLLNGNLAI
  SAIEQDILVKGTILKYSGSIATLERLQSFRPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATT
  NIIQPLLHAQWVLGDWSECSSTCGAGWQRRTVECRDPSGQASATCNKALKPEDAKPCESQLCPL

• Structural information:
  • Protein Domains: (219..42-)
    (/note="Peptidase-M12B)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00276-)
    (438..52-)
    (/note="Disintegrin-)
    (526..58-)
    1 (/note="TSP-type-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00210-)
    (833..88-)
    (/note="TSP-typ)
  • Interpro: IPR041645  IPR006586  IPR010294  IPR013273  IPR024079   IPR013277  IPR001590  IPR002870  IPR000884  IPR036383  
  • Prosite: PS50215 PS50092 PS00142
  • STRING: ENSP00000257359
• Other Databases: GeneCards:  ADAMTS8  Malacards:  ADAMTS8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0005178	integrin binding	TAS	molecular function
GO:0008237	metallopeptidase activity	TAS	molecular function
GO:0009673	low-affinity phosphate transmembrane transporter activity	TAS	molecular function
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0062023	collagen-containing extracellular matrix	ISS	colocalizes with
GO:0035435	phosphate ion transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq