Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 11091
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary
Gene Symbol WDR5   Gene   UCSC   Ensembl
Aliases BIG-3, CFAP89, SWD3
Gene name WD repeat domain 5
Alternate names WD repeat-containing protein 5, BMP2-induced 3-kb gene protein, SWD3, Set1c WD40 repeat protein, homolog, cilia and flagella associated protein 89,
Gene location 9q34.2 (134135381: 134159971)     Exons: 16     NC_000009.12
Gene summary(Entrez) This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
OMIM 609012

Protein Summary
Protein general information P61964  

Name: WD repeat containing protein 5 (BMP2 induced 3 kb gene protein)

Length: 334  Mass: 36588

Sequence MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAY
DGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFD
ESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPN
GKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGH
TDVVISTACHPTENIIASAALENDKTIKLWKSDC
Structural information
Interpro:  IPR020472  IPR037866  IPR015943  IPR001680  IPR019775  
IPR017986  IPR036322  
Prosite:   PS00678 PS50082 PS50294

PDB:  		 2CNX 2CO0 2G99 2G9A 2GNQ 2H13 2H14 2H68 2H6K 2H6N 2H6Q 2H9L 2H9M 2H9N 2H9P 2O9K 3EG6 3EMH 3MXX 3N0D 3N0E 3P4F 3PSL 3SMR 3UR4 3UVK 3UVL 3UVM 3UVN 3UVO 4A7J 4CY1 4CY2 4ERQ 4ERY 4ERZ 4ES0 4ESG 4EWR 4GM3 4GM8 4GM9 4GMB 4IA9 4O45 4QL1 4Y7R 5EAL 5EAM 5EAP 5EAR 5M23 5M25 5SXM 5VFC 6BYN 6D9X 6DAI 6DAK 6DAR 6DAS 6DY7 6DYA 6E1
PDBsum:   2CNX 2CO0 2G99 2G9A 2GNQ 2H13 2H14 2H68 2H6K 2H6N 2H6Q 2H9L 2H9M 2H9N 2H9P 2O9K 3EG6 3EMH 3MXX 3N0D 3N0E 3P4F 3PSL 3SMR 3UR4 3UVK 3UVL 3UVM 3UVN 3UVO 4A7J 4CY1 4CY2 4ERQ 4ERY 4ERZ 4ES0 4ESG 4EWR 4GM3 4GM8 4GM9 4GMB 4IA9 4O45 4QL1 4Y7R 5EAL 5EAM 5EAP 5EAR 5M23 5M25 5SXM 5VFC 6BYN 6D9X 6DAI 6DAK 6DAR 6DAS 6DY7 6DYA 6E1

DIP:  
29223
MINT:  
STRING:   ENSP00000351446
Other Databases GeneCards:  WDR5  Malacards:  WDR5

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0051572 negative regulation of hi
stone H3-K4 methylation
 IDA biological process
GO:0051571 positive regulation of hi
stone H3-K4 methylation
 IDA biological process
GO:0042393 histone binding
 IBA molecular function
GO:0051568 histone H3-K4 methylation
 IBA biological process
GO:0048188 Set1C/COMPASS complex
 IBA cellular component
GO:0005634 nucleus
 IBA cellular component
GO:0071339 MLL1 complex
 IDA cellular component
GO:0043995 histone acetyltransferase
activity (H4-K5 specific
)
 IDA contributes to
GO:0035097 histone methyltransferase
complex
 IDA cellular component
GO:0051568 histone H3-K4 methylation
 IDA biological process
GO:0048188 Set1C/COMPASS complex
 IDA cellular component
GO:0048188 Set1C/COMPASS complex
 IDA cellular component
GO:0046972 histone acetyltransferase
activity (H4-K16 specifi
c)
 IDA contributes to
GO:0043996 histone acetyltransferase
activity (H4-K8 specific
)
 IDA contributes to
GO:0043984 histone H4-K16 acetylatio
n
 IDA biological process
GO:0043982 histone H4-K8 acetylation
 IDA biological process
GO:0043981 histone H4-K5 acetylation
 IDA biological process
GO:0000123 histone acetyltransferase
complex
 IDA cellular component
GO:0044666 MLL3/4 complex
 IDA cellular component
GO:0035064 methylated histone bindin
g
 IDA molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0006325 chromatin organization
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0035097 histone methyltransferase
complex
 IDA cellular component
GO:0005634 nucleus
 IDA cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0043687 post-translational protei
n modification
 TAS biological process
GO:0045652 regulation of megakaryocy
te differentiation
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005634 nucleus
 IEA cellular component
GO:0051568 histone H3-K4 methylation
 IEA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0031175 neuron projection develop
ment
 IEA biological process
GO:0045722 positive regulation of gl
uconeogenesis
 IEA biological process
GO:0001501 skeletal system developme
nt
 IEA biological process
GO:0005671 Ada2/Gcn5/Ada3 transcript
ion activator complex
 IDA cellular component
GO:0043966 histone H3 acetylation
 IDA biological process
GO:0005634 nucleus
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0035064 methylated histone bindin
g
 IDA molecular function
GO:0042800 histone methyltransferase
activity (H3-K4 specific
)
 IDA contributes to
GO:0035097 histone methyltransferase
complex
 IDA cellular component
GO:0051568 histone H3-K4 methylation
 IDA biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04934Cushing syndrome

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
13 (5 controls,
8 cases)
 Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract
31037746 Spermatoge
nic defect
s
28 men with az
oospermia
 Male infertility Microarray
 Show abstract