• Gene id: 11086

Gene Summary

• Gene Symbol: ADAM29   Gene   UCSC   Ensembl
• Aliases: CT73, svph1
• Gene name: ADAM metallopeptidase domain 29
• Alternate names: disintegrin and metalloproteinase domain-containing protein 29, a disintegrin and metalloproteinase domain 29, cancer/testis antigen 73, epididymis secretory sperm binding protein, metallaproteinase-disintegrin (ADAM29), testis secretory sperm-binding protein ,
• Gene location: 4q34.1 (174918357: 174978179)     Exons: 9     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes
• OMIM: 604778

Protein Summary

• Protein general information: Q9UKF5  
  • Name: Disintegrin and metalloproteinase domain containing protein 29 (ADAM 29) (Cancer/testis antigen 73) (CT73)
  • Length: 820  
  • Mass: 92759
  • Tissue specificity: Expressed specifically in testes.
• Sequence:

  MKMLLLLHCLGVFLSCSGHIQDEHPQYHSPPDVVIPVRITGTTRGMTPPGWLSYILPFGGQKHIIHIKVKKLLFS
  KHLPVFTYTDQGAILEDQPFVQNNCYYHGYVEGDPESLVSLSTCFGGFQGILQINDFAYEIKPLAFSTTFEHLVY
  KMDSEEKQFSTMRSGFMQNEITCRMEFEEIDNSTQKQSSYVGWWIHFRIVEIVVVIDNYLYIRYERNDSKLLEDL
  YVIVNIVDSILDVIGVKVLLFGLEIWTNKNLIVVDDVRKSVHLYCKWKSENITPRMQHDTSHLFTTLGLRGLSGI
  GAFRGMCTPHRSCAIVTFMNKTLGTFSIAVAHHLGHNLGMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFW
  EYTVERTKCLLETVHTKDIFNVKRCGNGVVEEGEECDCGPLKHCAKDPCCLSNCTLTDGSTCAFGLCCKDCKFLP
  SGKVCRKEVNECDLPEWCNGTSHKCPDDFYVEDGIPCKERGYCYEKSCHDRNEQCRRIFGAGANTASETCYKELN
  TLGDRVGHCGIKNATYIKCNISDVQCGRIQCENVTEIPNMSDHTTVHWARFNDIMCWSTDYHLGMKGPDIGEVKD
  GTECGIDHICIHRHCVHITILNSNCSPAFCNKRGICNNKHHCHCNYLWDPPNCLIKGYGGSVDSGPPPKRKKKKK
  FCYLCILLLIVLFILLCCLYRLCKKSKPIKKQQDVQTPSAKEEEKIQRRPHELPPQSQPWVMPSQSQPPVTPSQS
  HPQVMPSQSQPPVTPSQSQPRVMPSQSQPPVMPSQSHPQLTPSQSQPPVTPSQRQPQLMPSQSQPPVTPS

• Structural information:
  • Protein Domains: (198..39-)
    (/note="Peptidase-M12B)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00276-)
    (397..48-)
    (/note="Disintegrin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00068-)
    (625..65-)
    (/note="EGF-like"-)
  • Interpro: IPR006586  IPR018358  IPR001762  IPR036436  IPR024079   IPR001590  IPR002870  IPR034027  
  • Prosite: PS50215 PS00427 PS50214
  • CDD: cd04269
  • STRING: ENSP00000484862
• Other Databases: GeneCards:  ADAM29  Malacards:  ADAM29

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IEA	biological process
GO:0004222	metalloendopeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008237	metallopeptidase activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007283	spermatogenesis	TAS	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)